KEGG   Rattus norvegicus (rat): 294250Help
Entry
294250            CDS       T01003                                 

Gene name
Prrc2a, Bat2
Definition
(RefSeq) proline-rich coiled-coil 2A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BAT2_N
Motif
Other DBs
NCBI-GeneID: 294250
NCBI-ProteinID: NP_997627
RGD: 1303025
Ensembl: ENSRNOG00000000852
Vega: OTTRNOG00000001927
UniProt: Q6MG48
Position
20p12
AA seq 2161 aa AA seqDB search
MSDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPA
NLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPPESQPLPASQTPASN
QPKRPPTAPENTPSVPSGVKSWAQASVTHGAHGDGGRASSLLSRFSREEFPTLQAAGDQD
KAAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGP
PQFPPYRGMMPPFMYPPYLPFPPPYGPQGPYRYPTPDGPSRFPRVAGPRGSGPPMRLVEP
VGRPSILKEDNLKEFDQLDQENDDGWAGAHEEVDYTEKLKFSDEEDGRDSDEEGAEGHKD
SQSAAGEEPETDGKKGTSPGSELPPPKTAWTENSRPSETEPAAPPIPKPPPPPPHRGPVG
NWGPPGDYPDRGGPPCKPPAPEDEDEAWRQRRKQSSSEISLAVERARRRREEEERRMQEE
RRAACAEKLKRLDEKFGAPDKRLKAEPAAPPVTPPAPALPPVVPKETPTPPALPPTPTPT
PEKDPEEPAHAPPVQSAPTQAGPPAPTPVSGGGTASSTSSGSFEASPAEPQLPSKEGPEP
PEEVPAPTTPPAPKVEPKGDGVGPTRQPPSQGLGYPKYQKSLPPRFQRQQQEQLLKQQQQ
QQWQQQQQQQGTAPPAPVPPSPPQPVTLGAVPAPQAPPPPPKALYPGALGRPPPMPPMNF
DPRWMMIPPYVDPRLLQGRPPLDFYPPGVHPSGLVPRERSDSGGSSSEPFERHAPPLLRE
RGTPPVDPKLAWVGDVFTTTPTDPRPLTSPLRQAADEEEKSLRSETPPVPPPPPYLANYP
GFPENGTPGPPISRFPLEESAPPGPRPLPWPPGNDEAAKMQAPPPKKEPPKEEPAQLSGP
EAGRKPARGVGGGGQGPPPPRRENRTETRWGPRPGSCRRGIPPEDPGVPPRRAGPIKKPP
PPVKADELPPKSLEPGDETPKAPKPDALKTAKGKVGPKETPAGGNLSPAPRLRRDYSYER
VGPTSCRGRGRGEYFARGRGFRGTYGGRGRGARSREFRSYREFRGDDGRGGGSGGTNHPS
APRGRTASETRSEGSEYEEIPKRRRQRGSETGSETHESDLAPSDKEAPPPKEGVLAQVPL
APPQPGAPPSPAPARFSTARGGRVFTPRGVPSRRGRGGGRPPPVCSGWSPPAKSLVPKKP
PTGPLPPNKEPLKEKLISGPLSPMSRAGNMGVGMEDGERPRRRRHGRAQQQDKPPRFRRL
KQDRENAARGTDGKPPPLTLPASTPAPTETLATVAAPPPPRRTAAKSPDLSNQNSDQANE
EWETASESSDFASERRGDKETPPAALITSKAVGTPGGNSGGAGPGISTMSRGDLSQRAKD
LSKRSFSSQRPGMDRQNRRPGAGGKTGGGGSSGGGGAGPGGRTGPGRGDKRSWPSPKNRS
RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGNVTAPGGHPRPK
PGPPQAPQGSSPRPPTHYDPPRASNAISSDPHFEEPGPMVRGVGGTPRDSAGVNPFPPKR
RERPPRKPELLQEETVPASHSSGFLGSKPEVPGPQEESRDSGTEALTPHIWNRLHTATSR
KSYQPGSIEPWMEPLSPFEDVAGTEMSQSDSGVDLSGGSQVSSGPCSQRSSPDGGLKGSA
EGPPRRPGGPSPLKAVPGESSSASEPSEPHRRRPPASHEGERKELPREQPLPPGPIGTER
SQRTDRGPEPGPLRPAHRAGSQVEFGTTNKDSDLCLVVGDTLKGEKELAASATEAVPVSR
DWELLPSASASAEPQAKSLGSGQCGPEPSPSGQRLYPEVFYGSPGPPNSQVSGGAPIDSQ
LHPSSGGFRPGTPSVHQYRSQPLYLPPGPAPPSALLSGVALKGQFLDFSALQATELGKLP
AGGVLYPPPSFLYSAAFCPSPLPDPPLLQVRQDLPSPSDFYSTPLQPGGQSGFLPSGAPA
QQMLLPVVDSQLPVVNFGSLPPAPPPAPPPLSLLPVGPALQPPNLAVRPPPAPAARVLPS
PARPFPASLGRAELHPVELKPFQDYRKLSSNLGGPGSSRAPPSGRSFSGLNSRLKAPPST
YSGVFRTQRIDLYQQASPPDALRWMPKPWERTGPPSREGPPRRAEEPGPRGEKEPGLPPP
R
NT seq 6486 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgctcggggccgactgccaaggggaaggatggaaagaagtattcctcgctc
aacctgtttgatacgtataagggcaagtccttagagatccagaaacccgccgttgcccct
cgacatggcctgcagagtctcggaaaagttgccattgcccggcgtatgccgcccccagcc
aaccttccaagcctgaaagccgagaacaaaggcaatgaccccaatgtctcactagtgccg
aaagacggaacaggatgggcaagcaaacaggagcagtccgaccccaagagttccgatgcc
tcaaccgctcagccgccggaatcgcagccactgccggcttcacagacgcctgcctccaac
cagccgaaacgacccccaacagcccccgagaacactccttcggttccaagcggggtaaag
tcctgggcacaggccagtgtcacccatggagcccatggagatggtggaagggcatcaagc
ctactgtcgcgattctctcgagaggaatttccgaccctgcaggcggctggcgaccaggac
aaggctgccaaggaaagggagtctgccgaacagtcgtctgggcccggaccaagcctccgc
ccccagaattctacaacttggagggacggaggtgggcgtggccctgatgaactggagggc
ccggactccaaacttcatcatggtcatgatccccggggtgggctgcagccttcaggccca
ccccagttccctccctaccgcggaatgatgccgccctttatgtatcccccatatctccca
tttcctccaccctatggaccccaggggccttacagatacccgactcctgatgggcccagc
cgttttccccgtgtggcgggcccccggggctcagggccaccaatgcgccttgtagagcct
gtgggtcggccttctattcttaaagaagataatctcaaagaatttgaccaattggaccag
gaaaatgatgatggttgggcaggggcccacgaggaggttgactacactgaaaagctcaag
ttcagcgatgaggaagatgggcgagactctgacgaggagggagctgagggccacaaggat
tcccagtcagctgctggtgaggaacctgagacagatggcaaaaagggcacctcccctggc
agcgaactgccccctcccaagacagcctggacagagaactctcggccttcagagacagag
ccagctgctcctcctatcccaaagcctcccccacctccacctcaccgggggcccgtcggg
aactgggggccccctggggactacccagatcgagggggtcctccctgcaaacccccagca
cctgaagatgaggatgaggcgtggcgacagcgtcgaaagcaatcttcctcagagatctcc
ctggcagtggaacgggcccgaagacgcagagaagaggaagagcgacgaatgcaggaggag
cgccgggcagcctgtgctgagaaacttaagcgtcttgatgaaaagttcggggcacctgac
aagcggctcaaagcggagcctgcagccccacctgttactcctcctgccccggctctacca
cctgtagtccccaaagagacccctacacctccagctctgccaccaacaccaaccccaacc
ccagagaaagaccctgaggagccagcacacgcccctcccgtgcagtccgcccccactcag
gctgggcctccagcccccactccggtgagtgggggtggcactgccagtagcaccagcagt
ggcagcttcgaagccagcccagcggaaccccagctgccttcaaaagagggtcctgaacca
ccagaagaggttcctgcacctaccacacccccagccccaaaggtggaacccaagggtgat
ggcgttggtcccactcgccagccccccagtcagggcttgggctatcccaaataccagaag
tcattgccacctcgcttccagcggcagcaacaggagcagctcctgaagcagcagcagcag
cagcagtggcagcagcagcagcaacaacaaggcactgcccctcctgccccagtgccccca
tcaccaccacagcctgtgaccctgggagctgtacctgccccacaggcaccgcccccacct
cccaaagccctgtacccaggtgctctgggccggcccccaccgatgcctccgatgaacttt
gatccccgctggatgatgattcctccttacgtggaccctcggcttctccagggccggccc
cctctggacttctaccctccgggtgtgcatccctctggcctggttccccgggaacgctca
gacagtgggggttcaagctcagagccatttgaacgccatgcaccccctctgttacgggaa
cggggcaccccaccagtggaccccaagttggcctgggtaggagatgtctttaccaccaca
cccaccgatcctcgccctcttacctcaccactgcgccaggcagcagatgaggaggagaag
agtctgaggagcgagactcctccagtacctccccccccaccttatctggctaattatcca
ggtttcccagagaatggaactcctgggcccccaatctcgagattccctctggaagaatca
gctcccccaggaccccgtccactaccctggcctccaggcaatgatgaggctgccaagatg
caagctccaccacccaagaaggaaccccccaaggaggaaccagcacagctgtccgggcca
gaagcaggcagaaagcctgcccgaggagttggaggtggaggccaaggcccaccaccacca
cgcagagagaatcgcactgagactcgctggggcccccggccaggcagttgtcgacgtggc
atccctccagaggaccctggtgtccctcctcgccgagctgggcctataaagaagccacca
ccccctgtgaaagcagatgagctgcctcctaagtccctagaaccaggggatgaaaccccc
aaggccccaaagccagatgcactcaagacagctaagggcaaggtgggccccaaagaaacc
ccagcgggtgggaacctgtctcctgcgcctagacttcgaagggactattcctatgaaaga
gtaggccctacgtcttgccgtggtcggggcagaggcgagtattttgccagaggaaggggt
ttccggggaacttatgggggccggggtcggggagcccggagccgtgaattccgaagttac
agagagtttcgaggagacgatggacgagggggtggttcaggaggaacaaaccacccttct
gctccccgaggccgcactgccagtgagacacgaagtgagggttcagagtatgaagaaatc
cccaagagacgtcgccagcgtggctctgaaacaggcagtgagactcatgagagtgacctg
gcaccctctgacaaggaagcccctccacccaaggagggagtgctagctcaggtccctctt
gcccccccacaaccaggagctcccccatcaccagccccagcccgattctccactgcccga
ggtggtcgtgtcttcactcccagaggagtgccatcgcgccgtggccgaggtgggggtcgg
ccccctcctgtttgctctggctggagccctccagccaagtccctggttccaaagaaacct
ccaacaggtcctttgcccccaaataaggagcctttgaaagagaagctgatctcagggcct
ctgtcccccatgtcccgagctggcaacatgggtgtgggcatggaagacggggagcgaccc
cggcggaggcgacatggcagggctcagcagcaggacaaaccaccgcgtttccgaaggctg
aaacaagaccgggaaaatgctgccagaggcaccgatggcaagccccctcccctaaccctt
ccagcctccacccctgcacccacggagacgctggccacagtcgcagctcccccaccccct
cgccgcacagctgctaagtctcctgatctgtcaaaccagaactcagaccaagccaatgag
gaatgggagactgcatcagagagcagcgactttgccagtgagcgccggggtgacaaggag
actcccccagcagcacttataacctctaaagctgtggggactcctgggggcaattcaggt
ggggccggaccaggcatttcaaccatgtctcgtggagacctgagtcagcgagccaaggat
ctgagcaagcggagcttctccagtcagcggccaggcatggatcgtcagaaccggcgccca
ggcgctgggggcaagactggcggtggtggcagtagtggaggtggtggtgcaggccctggg
ggacggactggcccaggacgaggggataagaggagctggccctctcccaaaaaccgaagc
cgtcctcctgaggagcgacctccgggacttcctctgcctccgccaccccccagcagttct
gctgttttccgcctggaccaagttatccacagcaaccctgctggcatccaacaagctctg
gcccaacttagcagccgccaaggaaatgtaactgcaccaggggggcacccaaggcctaag
cctgggcctccccaagcccctcagggctcctcccctcggcccccaacccattatgacccc
ccgagggccagcaacgctatcagctctgacccccacttcgaggagccagggccgatggtg
aggggggtgggcgggactccccgggactctgccggggttaatcccttccccccgaaacgg
cgggagcggcctccccgaaaaccggagctgctgcaggaggaaactgtgccagcttctcat
agctctggattcttgggctctaagcctgaggtcccaggccctcaggaagaatccagagat
tcaggcacagaggccctaactccccacatctggaatcgtttacatactgccacaagccga
aagagttaccagcctggctccatagagccctggatggagcccctgagcccctttgaggat
gtggcaggcacagagatgagtcagtctgacagtggggtggacctgagtggaggttctcag
gtgtcatcaggtccctgcagccaacgaagttcccccgatggaggacttaaggggtcagca
gagggaccccccaggcggcctggaggaccctcacccctaaaggctgttcctggtgagagt
tcatctgcctctgaaccctccgaacctcataggagacggccacctgcttcccatgagggg
gaaagaaaggagctgccccgggagcagcctctgccccctggtcccataggcacagaacga
tcacagcgcacagaccgaggcccagagccaggccctctccgaccagcccaccgagcgggc
tctcaagttgagtttggcacgaccaacaaggactcagacttgtgcctagtggtaggagac
actttaaaaggagagaaggagttggcggcatcagccacagaggccgtgcccgtatccaga
gactgggagctgctccccagtgcttctgcttcagctgagccacaggccaagagtctgggt
tctgggcagtgtggtccagagcccagcccttcaggtcagcgtctgtaccctgaggtcttc
tatggtagccctggacctccgaactcccaagtctctgggggtgcacctatcgactcccag
ttacatcccagcagtggaggcttccggcctgggacaccctcagtacaccagtacaggtca
cagcctctgtatctgcccccaggtcctgcccctccctcagcactgctctctggggtagct
ctcaagggccagtttctggatttctcagcactgcaagccacagagctggggaagttgcct
gctgggggagttctctaccctccaccgtccttcctctactctgcagctttctgccccagc
cctttgcctgacccacccttgcttcaggtacgccaggatctgccatccccttcagatttt
tactctacccctctgcagccaggtggccagagtggcttccttccttcaggagcccctgcg
cagcagatgcttctacctgtggtagactctcagctgccagtggtgaacttcggctccctg
ccgccagcgccaccccctgctccacctcctctttctctgttacctgtgggtcctgctctc
cagccccccaatctggctgtgcggcccccacctgctcctgctgcacgggtcttaccttca
cccgccaggccctttcccgctagcttggggcgagcggagctgcatccagtagagctaaag
cctttccaggattaccgaaagctgagcagcaaccttgggggtcctgggtcatcacgggct
cccccatctggaaggtccttctctggtctcaattcccggctcaaggccccaccttccacc
tacagtggagtattccggactcagcgcattgacctctaccagcaggcttccccaccagat
gccctgcgctggatgccgaagccttgggaacggacagggccaccttctcgagaagggcct
ccccgaagagcagaggagcccgggccccggggggagaaggagcctggattgcctccaccc
cgctga

DBGET integrated database retrieval system