KEGG   Rattus norvegicus (rat): 294251
Entry
294251            CDS       T01003                                 

Gene name
Ncr3, 1C7, Nkp30
Definition
(RefSeq) natural cytotoxicity triggering receptor 3
  KO
K06743  natural cytotoxicity triggering receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    294251 (Ncr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    294251 (Ncr3)
CD molecules [BR:rno04090]
 Proteins
  294251 (Ncr3)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig Ig_2
Other DBs
NCBI-GeneID: 294251
NCBI-ProteinID: NP_861543
RGD: 727881
Ensembl: ENSRNOG00000000854
Vega: OTTRNOG00000001928
UniProt: R9PXR3
Position
20p12
AA seq 195 aa
MGGMAKVLLVVFIMVYAGSCAVWVSQPPEIRAQEGTTASLPCSFNASRGKAAIGSATWYQ
DKVAPGMELSNVTPGFRGRVASFSVSQFIRGHKAGLLIQDIQSHDARIYVCRVEVLGLGV
GTGNGTRLVVEKEPPQQASNAEPERAAYTSLLLRAGVYALSFLSVATGSVIYYQGKCLCH
VGNTATPPTASEERF
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggaggtatggccaaggtgctgctggtcgtcttcatcatggtttatgcaggatcctgt
gctgtctgggtgtctcagccccctgagattcgtgcacaagagggcaccactgcctccctg
ccctgttcgttcaatgccagcagagggaaagcggccattggctctgccacatggtaccaa
gacaaagtagccccggggatggagttgagcaacgtgaccccagggttcaggggccgagtg
gcctctttttctgtttcccagttcattagaggccacaaggccgggctgctcatacaggac
atccaaagccatgacgccagaatctacgtgtgcagagtggaggtgctaggcctgggcgtc
ggaacaggaaacgggactcggctggtggtggagaaagagcctcctcaacaagcctccaac
gcagagccagagcgagctgcctacacaagtctcctccttcgcgctggcgtctatgccctc
agctttctctctgtggccaccggcagtgtcatctattaccagggcaaatgtctctgtcac
gtgggaaacaccgccactcctcccacagcctctgaggagcgattctaa

DBGET integrated database retrieval system