KEGG   Rattus norvegicus (rat): 294257
Entry
294257            CDS       T01003                                 

Gene name
Cfb, Bf, Da1-24
Definition
(RefSeq) complement factor B
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    294257 (Cfb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    294257 (Cfb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    294257 (Cfb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     294257 (Cfb)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   294257 (Cfb)
SSDB
Motif
Pfam: Trypsin VWA Sushi VWA_2 HRM DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 294257
NCBI-ProteinID: NP_997631
RGD: 2204
Ensembl: ENSRNOG00000051158
Vega: OTTRNOG00000001008
UniProt: Q6MG74 G3V615
Position
20p12
AA seq 763 aa
MTMEGPQLCLVLLVLGLSSGGVSATPVLEARPQVSCSLEGVEIKGGSFQLLQDGQALEYL
CPSGFYPYPVQTRTCKSTGSWSVLQTRDQKIVKKAECRAIRCPRPQDFENGEFWPRSPYY
NLSDQISFQCYDGYTLRGSANRTCQENGRWDGQTAICDDGAGYCPNPGIPIGTRKVGSQY
RLEDTVTYHCSRGLVLRGSQQRRCQEGGSWSGTEPSCQDSFMYDSPQEVAEAFLSSLTET
IEGADAEDGHSPGEQQKRKIILDPSGSMNIYMVLDGSDSIGASNFTGAKRCLANLIEKVA
SYGVKPRYGLVTYATVPKVLVRVSEERSSDADWVTEKLNQISYEDHKLKSGTNTKKALQA
VYSMMSWPGDAPPEGWNRTRHVIIIMTDGLHNMGGDPVTVIEDIRDLLDIGRDRKNPRED
YLDVYVFGVGPLVDPVNINALASKKNNEQHVFKVKDMEDLENVFYKMIDETKSLGLCGMV
WEHQKGGDYYKQPWQAKISVTRPLKGHENCMGAVVSEYFVLTAAHCFTVEDQKHSIKVNV
EGKRRDLEIEEVLFHPNYDINGKKAEGISEFYDYDVALIKLKTKLKYSQTLRPICLPCTE
GTTRALRLPQTATCKQHKEELLPMKDVKALFVSEEGKKLTRKEVYIKNGEKKASCERDAT
KAQGYEKVKVASEVVTPRFLCTGGVDPYADPNTCKGDSGGPLIVHKRSRFIQVGVISWGV
VDVCKDPRRQQLVPSYARDFHINLFQVLPWLKEKLKDEDLGFL
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgacaatggagggtccccagctctgcttagtcctcttggtcttaggcctctcctccgga
ggtgtgagcgcaactccagtgcttgaggcccggccccaggtctcttgctctctggaggga
gtagagatcaaaggcggctccttccaacttctccaagacggtcaggccctggagtacctg
tgtccctctggcttctacccataccctgtgcagactcgaacctgcaaatccacaggctcc
tggagtgtcctccagacccgggaccaaaagattgtcaagaaggcagaatgcagagcaata
cgctgcccacgaccacaggactttgaaaatggggagttctggccccggtccccctactac
aacctgagtgatcagatttcttttcaatgctatgatggctacactctccggggctctgct
aatcgcacctgccaagagaatggccggtgggatgggcaaacagcaatctgtgatgatgga
gcgggatactgtcccaacccgggtattcctattgggacaaggaaggtgggaagccagtac
cgtcttgaagacactgtcacttaccactgtagtcggggacttgtcctacgtggctcccag
cagcgaaggtgccaggaaggtggctcgtggagtgggacagagccttcctgccaagattcc
ttcatgtacgacagccctcaagaggtggccgaagcatttctatcctccctgacagagacc
atcgaaggagcagatgcggaggatgggcacagcccaggggaacagcagaagaggaagatt
atcctggacccctcgggctccatgaatatctacatggtgctggatggatccgacagcatc
ggggccagcaacttcacaggggccaagcggtgtctcgccaacttgattgagaaggtggcg
agttatggggtgaagccaagatacggtctagtgacatatgccacagtccccaaagtcttg
gtcagagtgtctgaggagaggagtagtgatgccgactgggtcacagagaagctcaaccaa
atcagttatgaagaccacaagctgaagtcagggaccaacaccaagaaggctctccaggct
gtatacagcatgatgagctggccaggggatgctccgcctgaaggctggaatcgaacccgc
cacgtcatcatcatcatgactgatggcttgcacaacatgggtggagaccctgtcactgtc
attgaggacatccgagacttgctggatattggcagggatcgcaaaaatccccgggaggat
tatttggatgtgtatgtgtttggggtcgggcctctggtggaccctgtgaacatcaatgcc
ttggcttccaaaaagaacaatgagcagcatgtgttcaaggtcaaggacatggaggatctg
gagaacgtcttctacaaaatgatcgatgaaaccaaatctctgggtctctgtggcatggtg
tgggagcatcagaaaggcggtgattattacaagcaaccatggcaagccaagatctcagtc
actcgtcctctgaaaggacatgagaactgtatgggggccgtggtgtccgagtacttcgtg
ctgacagcagcgcattgcttcacagtggaagatcagaaacactccatcaaggtcaacgtg
gaggggaaaaggcgggacctggagattgaagaggtcctgttccaccctaattacgacatc
aatgggaaaaaggcagaaggaatctctgagttctatgactatgatgttgccctcatcaag
ctcaagaccaagctgaagtacagccagactctcaggcccatctgtctcccctgcacagag
ggaaccacccgagccttgcggcttcctcagacagccacctgcaaacagcacaaggaagag
ttgctccctatgaaggacgtcaaagctctgtttgtatccgaggaagggaagaagctgacc
cggaaggaggtgtacatcaagaatggggaaaagaaagccagttgtgagagagatgctaca
aaggcccaaggctatgagaaggtcaaagttgcctctgaggtggtcacccccaggttcctg
tgcaccggaggggtagatccctatgctgaccccaacacatgcaaaggagactccgggggc
cctctcattgttcacaagagaagccgcttcattcaagttggtgtgatcagctggggagta
gtggatgtctgcaaagacccgaggcggcaacagttggtgccctcctatgcccgggacttc
cacatcaatctcttccaggtgctgccctggctaaaggagaagctcaaagacgaggacttg
ggtttcttataa

DBGET integrated database retrieval system