KEGG   Rattus norvegicus (rat): 294258Help
Entry
294258            CDS       T01003                                 

Gene name
Nelfe, Rd, Rdbp
Definition
(RefSeq) negative elongation factor complex member E
  KO
K15182  negative elongation factor E
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    294258 (Nelfe)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     294258 (Nelfe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 294258
NCBI-ProteinID: NP_001159373
RGD: 1303325
Ensembl: ENSRNOG00000000420
Vega: OTTRNOG00000001007
UniProt: Q6MG75
Position
20p12
AA seq 369 aa AA seqDB search
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSGTASQGGVKRSLSEQPVVDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDL
QEPSRRPQRKSLYESFVSSSDRLRELGQDGEEAEAPGAGEGPPRGFDWSYEEHSGARSSA
SPPRSRSRDRSHDRSRDRDRDKERDRDRDRDRERDKDKDRDRDRDRDKERDRDRDRERDR
EGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTY
EKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKR
TQIVYSDDL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgatacctccggggctgagtgaagaggaagaggcactacagaagaaattcaac
aaactcaagaaaaagaaaaaggcgttgctggctctgaagaagcaaagcagcagtggtaca
gcgagccagggcggtgtcaagcgctcactgtcagagcagcctgtggtggatactgccaca
gcaacagaacaggccaaacagctggtgaagtcaggagctatcagtgccatcaaggctgaa
actaagaactcaggcttcaaacgttctcggaccctggaagggaagttaaaggacccagag
aaggggcctgtccccaccttccagccgttccagaggagcatgtctgctgacgaggaccta
caggagccatccagacggccccaaaggaaatctctgtatgaaagctttgtgtcttctagt
gatcggcttcgggaactgggacaagatggagaagaagcagaggcccctggggctggtgaa
ggcccacctcgaggttttgactggagctatgaagaacacagcggtgcccgatcctcagcc
tcccctccccgaagccgcagccgggacagaagtcatgatcggagccgagatagggaccgg
gacaaagaacgagacagagaccgggatcgagacagagaacgggacaaagacaaagacaga
gaccgggaccgggacagagacaaagagcgggacagagacagggaccgggagcgagaccga
gagggccctttccgtaggtcagactcattccccgaacggagggcccctcgaaaggggaac
actctgtatgtgtatggagaggacatgacgcccaccctcctccgaggggccttctctccc
tttggaaatatcatcgacctctccatggacccacccagaaactgtgccttcgtcacctac
gagaagatggagtcagcagatcaggctgttgctgagctcaatgggacccaggtggaatct
gtgcagctcaaagtcaacatagcccgaaaacagcccatgctggacgctgctactggcaaa
tctgtctggggctcccttgctgtccagaacagccccaagggttgccaccgggacaagagg
acccagattgtgtacagtgacgatctatag

DBGET integrated database retrieval system