KEGG   Rattus norvegicus (rat): 29428Help
Entry
29428             CDS       T01003                                 

Gene name
Celf2, Brunol3, Cugbp2, Etr3, Napor
Definition
(RefSeq) CUGBP, Elav-like family member 2
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    29428 (Celf2)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    29428 (Celf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RNA_bind RRM_7 PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 29428
NCBI-ProteinID: NP_058893
RGD: 68347
Ensembl: ENSRNOG00000023661
UniProt: Q792H5
Position
17q12.3
AA seq 532 aa AA seqDB search
MFERTSELAFVETISVESMRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKM
FVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNA
LHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECR
ILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQ
QQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQN
LATLAAAAAAAQTSATSTNANPLSSTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQ
GLAGATVGLNNINALAVAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAA
ALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFI
DKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcgcacttctgaactggcttttgttgagactatcagtgtagaaagcatgcgc
tgtcccaaatccgctgttactatgagaaatgaggagctgcttttaagtaacggcacagcc
aacaagatgaacggagctttggatcattccgaccagccagacccagatgccattaagatg
tttgtcggacagatccctaggtcctggtcagaaaaggagctgaaagaactttttgagcct
tatggagctgtctaccagatcaacgtcctccgggaccggagtcagaaccctccccagagc
aaaggttgttgtttcgtaacattttatacaagaaaagctgcacttgaggcccagaatgca
ctgcacaatattaaaactttacctgggatgcatcatcccattcagatgaaacctgcagat
agtgaaaagtcaaacgctgtggaagaccgaaaattgttcataggaatggtttccaagaag
tgtaacgagaatgacatcagagtgatgttttctcccttcggtcagatagaagaatgccgg
attctccggggacctgacgggctgagtcgaggctgtgcgtttgtcacattttctaccagg
gcaatggcacagaatgcaatcaaagccatgcatcagtctcagaccatggagggctgctct
tcacctatcgtggtgaagttcgctgacactcagaaggacaaggagcaaaggcgcctccag
cagcagcttgcacagcagatgcaacagctcaacactgccacttgggggaacctgacagga
ctgggtggacttaccccacagtacctggcgcttctgcagcaggccacctcctccagcaac
ctgggtgcattcagtggcattcagcaaatggctggcatgaatgctttacagttacagaat
ctggcaacgctggctgcagctgcagctgccgcccaaacctcagccaccagcaccaatgca
aaccctctctccagcacaagcagtgccctgggggccctcacaagtcccgtggctgcttca
acccccaattctactgctggtgcagccatgaactccttgacctctcttgggactctgcaa
ggattggctggagccactgtcggattgaataatattaatgcactagcagttgctcaaatg
ctctcaggtatggcggctctgaatggaggacttggcgccacaggcttgacgaatggtacg
gctggcaccatggacgccctcacgcaggcctactcaggaattcagcagtacgcggcagct
gcactgcccactttgtacagccagagcctgctgcagcagcagagcgctgcaggcagccag
aaggaaggtccagagggggcaaacctctttatttaccaccttccacaggagtttggagac
caggacattctgcagatgttcatgccctttggaaatgttatctctgctaaagtcttcatt
gacaaacagaccaatctgagcaagtgctttggttttgttagctatgacaatccagtctct
gcacaagctgcaatccaggctatgaacggctttcagatcggcatgaaacgcttgaaggtg
cagctgaagcgctccaaaaacgacagcaaaccttactga

DBGET integrated database retrieval system