KEGG   Rattus norvegicus (rat): 29431Help
Entry
29431             CDS       T01003                                 

Gene name
Pak1
Definition
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04360  Axon guidance
rno04392  Hippo signaling pathway - multiple species
rno04510  Focal adhesion
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29431 (Pak1)
   04010 MAPK signaling pathway
    29431 (Pak1)
   04012 ErbB signaling pathway
    29431 (Pak1)
   04392 Hippo signaling pathway - multiple species
    29431 (Pak1)
   04024 cAMP signaling pathway
    29431 (Pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29431 (Pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29431 (Pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    29431 (Pak1)
   04650 Natural killer cell mediated cytotoxicity
    29431 (Pak1)
   04660 T cell receptor signaling pathway
    29431 (Pak1)
   04666 Fc gamma R-mediated phagocytosis
    29431 (Pak1)
   04062 Chemokine signaling pathway
    29431 (Pak1)
  09158 Development and regeneration
   04360 Axon guidance
    29431 (Pak1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29431 (Pak1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    29431 (Pak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29431 (Pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29431 (Pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29431 (Pak1)
   03036 Chromosome and associated proteins [BR:rno03036]
    29431 (Pak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29431 (Pak1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   29431 (Pak1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    29431 (Pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    29431 (Pak1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     29431 (Pak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Motif
Other DBs
NCBI-GeneID: 29431
NCBI-ProteinID: NP_058894
RGD: 3250
Ensembl: ENSRNOG00000029784
UniProt: P35465
Structure
PDB: 

Position
1q32
AA seq 544 aa AA seqDB search
MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILA
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataacggcttagacgtccaggacaaacccccagcccctccgatgagaaacacc
agcactatgattggagctggcagcaaagaccctggaaccctaaaccacggttccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccggttctatcgatccatcttagct
ggagataaaacaaataaaaagaaggagaaggagcggccagagatttctcttccttcagat
tttgagcatacaattcatgttggttttgatgctgtcacaggggagtttacggggatgcca
gaacagtgggcccgcttgcttcaaacatcaaatatcaccaagtcagagcagaagaaaaac
ccacaggctgttctggatgtgttggaattttataactccaagaagacctccaatagtcag
aagtacatgagttttacagataagtcagctgaagattataattcttctaatactttgaat
gtgaagactgtgtctgagaccccagcagtgccaccagtgtcagaagatgaagatgatgat
gacgatgctaccccacctccagtgattgctccacgcccagaacacacaaaatctgtatat
acacggtctgtgattgaaccacttcctgttactccaactcgggatgtggctacatctcct
atttctcctactgagaataacaccactccgccagatgctttgacccggaatactgaaaag
cagaagaagaagcctaaaatgtctgatgaggagatcttagagaaattacggagcatagtg
agtgtgggcgatcctaagaagaagtacacacgcttcgagaagattggacaaggtgcttca
ggcacagtgtacactgcaatggatgtagccacagggcaggaggtggccattaaacagatg
aaccttcagcagcagccgaagaaagaactcattattaatgagatcctggtcatgagggaa
aacaaaaacccaaacattgtgaactatctggacagttaccttgtgggagatgagctatgg
gttgtcatggaatacttggccggaggctccttaacagatgtggtgacagaaacctgtatg
gatgaaggccagatagcagctgtgtgccgagagtgtctacaagctttggagttcctgcat
tcaaaccaagtcattcacagagacatcaagagtgacaatattctgctgggaatggatggc
tctgtcaaattaactgactttggattctgtgcacagataactccagagcagagcaaaagg
agcaccatggtgggaactccatattggatggcacctgaagttgtgacacgcaaggcctat
ggacccaaggttgacatctggtccctgggtattatggcaattgaaatgattgagggggag
cccccatacctcaatgaaaaccctttgagagccttgtacctcattgctaccaatgggacg
ccagagcttcagaacccagagaagttgtcagctattttccgggactttttgaaccgctgt
cttgagatggatgtggagaagagaggttcagctaaagagctactgcagcatcaattcctg
aagattgccaagcctctctccagcctgactccactgattgctgcagcaaaagaggcaacc
aagaacaatcactga

DBGET integrated database retrieval system