KEGG   Rattus norvegicus (rat): 294312Help
Entry
294312            CDS       T01003                                 

Gene name
Pi16
Definition
(RefSeq) peptidase inhibitor 16
  KO
K20412  peptidase inhibitor 16
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    294312 (Pi16)
CD molecules [BR:rno04090]
 Proteins
  294312 (Pi16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 294312
NCBI-ProteinID: NP_001163952
RGD: 1304760
Ensembl: ENSRNOG00000000525
UniProt: D3ZGM7
Position
20p12
AA seq 483 aa AA seqDB search
MHSSCSPWVMLPQLPLLLLLLLLLLTATGPATALTEDEKQTMVELHNHYRAQVSPPASDM
LQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYN
LSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGR
KPYQEGTPCSQCPLGYSCVNSLCEPERKPEKAQDSPPRVTEVPGSRETGIPSLATSESLH
FSSVTKVSDSLATEPSPAVETKAPPSLATEGPSSMATEAQSFLTEVPSVSATHIQPSLDE
GPVNFLTSTHIPVPKSTDKEASSKSRAASVSPEKSLYPKMSPTETGESPPQIQEEAEPKA
ELPEREDELPEAEVELPEAEAELPEAKAELPVSSEALVPVLPAQERGGPKASLEHSSYPV
PTYLPNFPSASGNATGGRTLALQSSRTGAEDPEKASWDSKNSAPVWGPFPGLLLPLLLLA
GIF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcctgcagcccgtgggtgatgctgccccagctgccactgctgctcctgttg
cttctgctgctgctgactgccactggccccgccacagccctcacagaggacgagaagcaa
accatggtggagcttcacaaccactaccgcgcccaggtgtccccgccagcctcagacatg
ctgcagatgaggtgggacgacgagctggccgccttcgccaaggcctacgctcagaagtgc
gtgtggggacacaacaaggagcgcgggcggcgcggagagaacctgtttgccatcacggac
gagggcatggatgtaccgctggccgtggggaactggcacgaggagcatgaatattacaat
ctcagcacagccacctgtgatccgggccagatgtgcggccactacactcaggtagtgtgg
agcaaaactgagagaatcggctgtggttcccacttctgcgagacgctccagggagtggag
gaagctaacatccatttgctggtgtgcaactatgagcccccggggaacgtgaagggccgg
aagccctaccaggaggggacgccttgctcccagtgccctcttggctacagctgcgtgaac
tctctctgtgagccggagagaaaaccggaaaaagcgcaggattcgcctccaagggtgact
gaagtcccaggctccagggaaaccggtattccatccctagcaacctctgaatctctacat
ttctcctcggtaacaaaggtctcggactccctggcaaccgagccctcacctgcggtagaa
acaaaggccccaccttccttagcaaccgaaggcccctcctccatggcaacagaggctcag
tcttttctaactgaggtcccctcggtttctgcaacgcacatccagccttcactggatgaa
gggccagttaacttcctcacatcaacacacatccctgtccccaaatctacggacaaagaa
gccagcagcaagtcgagagcagcctccgtgagcccagagaaatctctgtaccccaagatg
tccccgacagagacaggagagtccccaccccaaatccaggaggaggctgagcccaaggcc
gagttgcctgagcgggaggacgagttgcccgaggcagaggtcgaattgcctgaggcagag
gccgagttgccagaggccaaggccgagttgcctgtttccagtgaggctttggtcccagtt
cttccagctcaggagcgcggtgggccgaaggcctcactggaacactccagctaccctgtc
cccacatatctgcccaacttccctagtgcctcgggcaatgccacaggtgggcgcaccctg
gccctacaatcatcccggacaggtgcagaggaccctgaaaaggccagctgggattcgaag
aactctgctcctgtgtggggccctttcccgggactgctgctgcctctcctgctgttggct
ggcatattctga

DBGET integrated database retrieval system