KEGG   Rattus norvegicus (rat): 294313Help
Entry
294313            CDS       T01003                                 

Gene name
Mtch1
Definition
(RefSeq) mitochondrial carrier 1
  KO
K17885  mitochondrial carrier
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    294313 (Mtch1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    294313 (Mtch1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    294313 (Mtch1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   294313 (Mtch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 294313
NCBI-ProteinID: NP_001094303
RGD: 1309262
Ensembl: ENSRNOG00000000527
UniProt: B0BN30
Position
20p12
AA seq 389 aa AA seqDB search
MGASDPEVAPWAPGRAAGMAGAGAGAGARGGAPAGVEARARDPPPAHRAHPRHPRPAAQP
SARRMDGGAGVPGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN
VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ
VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI
GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG
SQFSQALAIRSYTKFAMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW
KYLSVQGQLFRGSSLLFRRVSSGSCFALE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggggcctcggacccggaagtggcgccttgggctccgggccgcgccgcggggatggcg
ggagccggagctggtgcaggagctcggggcggcgcgccggcgggagtcgaggcccgcgct
cgggacccgccacccgcgcaccgcgcgcaccctcgccatcctcggcccgcggctcagccg
tcggcgcgcaggatggacggcggcgcgggcgtcccgggctccggggacaacgccccgacc
accgaggcgctgtttgtggcgctgggcgcgggcgtgaccgctctcagccacccgctgctc
tacgtgaagctgctgatccaggtgggtcatgagccgatgccccccacccttgggaccaat
gtgctggggaggaaagtcctctacctgccgagcttcttcacctatgccaagtacattgtg
caggtggatgggaagatagggttgttccggggcctgagcccccgcctgatgtctaacgcc
ttgtccactgtgacccggggcagcatgaaaaaggtcttccctccagacgagatcgagcag
gtttccaacaaggatgacatgaagacctcactgaagaaagttgtgaaggagacgtcctat
gagatgatgatgcagtgcgtgtcgcgcatgctggcccatcccttacatgtgatctcgatg
cgctgcatggtacagttcgtaggacgtgaggccaagtacagtggcgtgctgagctccatt
gggaagattttcaaggaggaggggctgctgggattcttcgtcggcttaatccctcacctc
ctgggcgatgtggttttcttgtggggctgtaacctgctggcccacttcatcaatgcctac
ttggtggacgacagcgtgagtgacaccccaggggggctgggaaacgaccagaatccaggt
tcccagttcagccaggccctggccatccggagctataccaagtttgcgatggggattgca
gtgagcatgctgacctatcccttcctgctcgttggagatctcatggcagtaaacaactgt
ggactgcaggctggactccctccgtattcccctgtgtttaagtcctggatccactgctgg
aagtacttgagtgtgcagggccagctcttccgtggctctagcctgcttttccgccgggtg
tcatcagggtcgtgctttgccctggagtaa

DBGET integrated database retrieval system