KEGG   Rattus norvegicus (rat): 29432Help
Entry
29432             CDS       T01003                                 

Gene name
Pak2, PAK-2, gamma-PAK
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29432 (Pak2)
   04010 MAPK signaling pathway
    29432 (Pak2)
   04012 ErbB signaling pathway
    29432 (Pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29432 (Pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29432 (Pak2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    29432 (Pak2)
  09158 Development and regeneration
   04360 Axon guidance
    29432 (Pak2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    29432 (Pak2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29432 (Pak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29432 (Pak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29432 (Pak2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   29432 (Pak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 29432
NCBI-ProteinID: NP_445758
RGD: 61953
Ensembl: ENSRNOG00000048597
UniProt: Q64303
Position
11q22
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEYTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTREAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggggagctagaggacaagcccccagcacctccagtgcggatgagcagc
accatttttagcactggaggaaaggatcctttatcagccaatcacagtttgaagcctttg
ccttctgttccagaggaaaaaaaaccgaggaacaaaatcatctccatattctcaagcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctccgccgtctgatttt
gagtataccatccatgttggctttgatgctgttacgggagagttcactggcatgccagag
cagtgggcacggctgttgcagacctccaacattaccaaactggagcagaagaagaacccg
caggctgtgctggatgtcttgaagttctacgactccaacactgtgaagcagaagtacctg
agcttcactcctcctgagaaagatggctttccttctggaacaccagcactgaacaccaag
gggtcagagacatcagctgtggtgacagaggaagacgatgacgatgaagatgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatctacacaaggtctgtcatcgac
cctattcctgctccagttggtgactctaatgtcgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatacacaagatatgaaaaaatcgggcaaggggcttct
ggtacagtttttactgcaactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaggag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagacgagttgttt
gtggtaatggagtaccttgctggtgggtccctcactgatgtcgtgacagaaacctgcatg
gatgaagcgcagatcgcagctgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaactcactgattttggcttctgtgcccagatcacccctgaacagagcaaacgc
agtacaatggttggaacgccatactggatggcaccggaggtagtcacgcgggaagcctat
ggccccaaagttgacatatggtctctgggcatcatggctatcgaaatggtggaaggagag
cctccatacctcaatgaaaatcctttacgggcattatacctgatagcaacgaatggaaca
cctgagctccagaatccagaaaaactttcccccatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaagaggggttcagccaaagaactattacagcatcctttcctg
aaactggccaaaccattatccagcttgacgcctctgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

DBGET integrated database retrieval system