KEGG   Rattus norvegicus (rat): 294328Help
Entry
294328            CDS       T01003                                 

Gene name
Aire
Definition
(RefSeq) autoimmune regulator
  KO
K10603  autoimmune regulator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    294328 (Aire)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    294328 (Aire)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    294328 (Aire)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    294328 (Aire)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSR PHD SAND PHD_2
Motif
Other DBs
NCBI-GeneID: 294328
NCBI-ProteinID: NP_001099849
RGD: 1311139
Ensembl: ENSRNOG00000001213
UniProt: D3ZV49
Position
20p12
AA seq 547 aa AA seqDB search
MAGGDGMLRRLLRLHRTEIAVAIDSAFPLLHALADHDVVPEDKFQETLRLKEKEGCPQAF
HALLSWLLTRDSGAILDFWRVLFKDYNLERYSRLHTILDGFPKDVDLSQPRKGRKPLAGP
KASVVPPRPPTKRRALEEPRATPPATLASKSISSPGSHSKAKPPKKPEGNLESQRLPLGN
GIQTMAASVQRAVTVSSGDVPGSRGAVEGILIQQVFESGGSKKCIQVGGEFYKPSKFEDP
SGNLKNKTRGGSSLKPVIRGKGTQGRDEQKVSQQCGVPPLPPLPNEPQVHQKNEDECAVC
HDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSCCLQGRIQQNLSQPEESRPLEPSA
ETPILLGLRSASEKTRVLSRELPAGSDAAVTYANLLAPPSTAPVLEPSALCPLPSAGAEG
QPGPTLSARCGVCGDSTDVLRCAHCAAAFHWRCHFPMAAVRPGTNLRCKSCSAEPTPTPG
VPGEAVPTAVRPTPGLAKVGDDSASHDPVLHRDDLESLLNEHSFDGILQWAIQSMSRPLA
ETPPFSS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggggatgggatgctgcgccgcctgctgaggctgcaccgcaccgagatcgca
gtggccatagacagcgcctttccgctgctgcatgctctggccgaccacgacgtggtccct
gaggacaagttccaggagacactccggctgaaagagaaggaaggctgcccccaggccttc
cacgccctgctgtcctggctcctgactcgggacagtggggccatcctggatttctggagg
gttctctttaaggactacaatctggagcggtacagccgcctgcataccatcctggacggc
tttccaaaagatgtggaccttagccagcctcggaaagggaggaagccccttgctggtccc
aaggcttcagtagtgccacccagaccccccacaaagagaagagccctggaagagcctcga
gccaccccaccagcaactctggcctcaaagagcatctctagcccaggttcccactcaaag
gccaaaccccctaagaagccagagggcaacttggagtcacagcgcctcccactgggaaac
ggaatccagaccatggcagcttctgtccagagagctgtgactgtgtcctccggggatgtc
ccaggatcccgaggggctgtggaagggatccttatccagcaagtattcgagtcaggagga
tccaagaagtgcatccaggttggaggggagttttataaacccagcaagttcgaagacccc
agtggcaatttgaagaacaagacccgaggtggtagcagcctaaagccagtgatccgagga
aagggaacccagggtagagatgagcagaaagtgagccagcagtgtggggtccctcccctt
ccacctcttcccaatgagccccaagttcaccagaagaacgaggatgaatgcgctgtgtgc
catgacggaggcgagctcatctgctgtgacggctgtccccgcgccttccacctggcttgc
ctgtccccacctctgcaggagatccccagtggcctttggagatgttcgtgctgcctccag
ggcagaatccagcagaacctgtcccagcctgaggagtccaggcccctggagccatctgca
gagaccccgattctcctgggactgaggtcagcttccgagaaaaccagggtcctgtccagg
gagctgccagccggctcagatgctgcagtcacatatgcgaacctgctggccccaccttcc
acagcccctgttctggagccttcagcactctgccctctaccgagtgctggggcggaaggg
cagccgggtccgacactgagcgcgcgatgcggtgtgtgcggcgactccaccgacgtgctg
cggtgcgcacactgtgccgctgcctttcactggcgctgccacttcccgatggctgctgtc
cggccagggaccaatctccgctgcaagtcctgctcggcagaaccgactcccacgccaggc
gtgccaggcgaggctgtgcccaccgctgtgcgtcccacacctgggcttgccaaggtaggg
gacgactctgctagtcatgaccctgttctgcatagggatgacctggagtccctcctgaat
gagcactcctttgacggcatcctgcagtgggccatccagagcatgtcacgcccgctggcc
gagacaccacccttttcttcctga

DBGET integrated database retrieval system