KEGG   Rattus norvegicus (rat): 294329Help
Entry
294329            CDS       T01003                                 

Gene name
Trpm2, Trpm2-predicted
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 2
  KO
K04977  transient receptor potential cation channel subfamily M member 2 [EC:3.6.1.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    294329 (Trpm2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    294329 (Trpm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    294329 (Trpm2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     294329 (Trpm2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   294329 (Trpm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans PKD_channel Eaf7 XhlA
Motif
Other DBs
NCBI-GeneID: 294329
NCBI-ProteinID: NP_001011559
RGD: 1311889
Ensembl: ENSRNOG00000001216
UniProt: E9PTA2
Position
20p12
AA seq 1508 aa AA seqDB search
MEPLDQRRTDSDQEEGFGVQSRRATDLGMVPNLRRSNSSLCKSRRLLCSFSSEKQENLSS
WIPENIKKKECVYFVESSKLSDAGKVVCECGYTHEQHIEVAIKPHTFQGKEWDPKKHVHE
MPTDAFGDIVFTGLSQKVGKYVRLSQDTSSIVIYQLMTQHWGLDVPSLLISVTGGAKNFN
MKLRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGDVITIGI
ATWGTIHNREALIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPL
RTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAITNGTPCVIVEGSGRVAD
VIAQVAALPVSEITISLIQQKLSVFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTVFRE
GKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKP
SDLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLA
EEHERLAYASETPRLQMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSLPMPHIKLNVQG
VSLRSLYKRSTGHVTFTIDPVRDLLIWAIIQNHRELAGIIWAQSQDCTAAALACSKILKE
LSKEEEDTDSSEEMLALADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLA
LEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLFTGFISFREKRLQAL
CRPARVRAFFNAPVVIFYLNILSYFAFLCLFAYVLMVDFQPSPSWCEYLIYLWLFSLVCE
ETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIAGLTCRLIPATLYPGRIILSLD
FIMFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNESR
VDWIFRGVIYHSYLTIFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPE
WLTVTLLCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGRPPAPP
PLILLSHLQLLIKRIVLKIPAKRHKQLKNKLEKNEEAALLSWELYLKENYLQNQQYQHKQ
RPEQKIQDISEKVDTMVDLLDMDRVKRSGSTEQRLASLEEQVTQMGRSLHWIVTTLKDSG
FGSGAGALTLAAQRAFDEPDAELSIRKKGEEGGDGYHVSARHLLYPDARIMRFPVPNEKV
PWEAEFLIYDPPFYTAEKKDATLTDPVGDTAEPLSKINYNVVDGLMDRCSFHGTYVVQYG
FPLNPMGRTGLRGRGSLSWFGPNHTLQPVVTRWKRNQGGGICRKSVRKMLEVLVMKLPQS
EHWALPGGSREPGKMLPRKLKQVLQQEYWVTFETLLRQGTEVYKGYVDDPRNTDNAWIET
VAVSIHFQDQNDVELKRLEENLQTHDPKESARGLEMSTEWQVVDRRIPLYVNHKKILQKV
ASLFGAHF
NT seq 4527 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttggaccagagaagaactgactctgatcaagaggagggctttggggtgcag
tcccggagggccactgatctgggcatggtccccaatctccgacgaagcaatagcagtctt
tgcaagagcaggaggcttctgtgctccttcagcagtgagaagcaagaaaaccttagctca
tggattcccgagaacatcaagaagaaggaatgtgtgtatttcgtggaaagttccaagctc
tcggatgcagggaaggtagtgtgtgagtgtggttacacccacgagcagcacattgaagtg
gccatcaagcctcacaccttccagggcaaggagtgggacccaaagaaacacgtccatgag
atgcctacagatgcctttggtgacattgtcttcaccggcctgagccagaaagtggggaag
tatgtccgactctcccaggacacgtcgtccattgtcatctaccagcttatgacacagcac
tggggcctggatgtccccagcctcctcatctctgtgaccggtggggccaagaacttcaac
atgaagctgaggttgaagagcatcttccggagaggcctggttaaggtggcccaaaccacg
ggggcctggatcatcactgggggttcccacaccggtgtgatgaagcaggtgggcgaggcg
gtacgggacttcagcctaagcagcagctgcaaagaaggcgacgtcatcaccatcggcata
gccacgtggggcaccatccacaaccgtgaggcactgatccatcccatgggaggcttcccc
gctgagtacatgctggatgaggaaggccaagggaacctgacctgcctggacagcaaccac
tcccacttcatcctggtggatgatgggacccacgggcagtatggtgtggagattccgctg
aggactaagctggagaagttcatatcggagcaaacgaaggaaagagggggtgtggccatt
aagatccccattgtctgcgtggtgttggagggtggccctggcactctgcataccatctac
aacgccatcaccaatggcacaccctgcgtgatagtggagggctccggccgagtggctgac
gtcatcgctcaggtggccgctctgcccgtctctgagatcaccatctccctgatccagcag
aagctcagcgtcttcttccaggagatgtttgagactttcaccgaaaaccagattgtggaa
tggaccaaaaagatccaagatattgtcaggaggcggcagctgctgacggtcttccgggaa
ggcaaggatggtcagcaggatgtggatgttgccattctgcaagctttactgaaagcctct
cgaagccaagatcacttcggccacgagaactgggaccatcagctgaagctggccgtggcc
tggaaccgtgtggacatcgcccgcagtgagatcttcactgatgagtggcagtggaagcct
tcagacctgcatcccatgatgacagctgccctcatctccaacaagcctgagtttgtgagg
ctctttctggagaacggggtgcggctgaaggagtttgtcacctgggatactcttctctgc
ctctacgagaacctggagccatcctgccttttccacagcaagctgcagaaggtgctggca
gaagagcatgaacgcttagcctatgcatctgagacaccccggctgcaaatgcaccacgtg
gcccaggtgctgcgtgagctcctcggagactccacacagctgctgtatccccggccccgg
tacactgaccggccacggctctcgctgcccatgccacacatcaaactcaacgtgcaagga
gtgagcctccggtctctctataagcgatcaacaggccacgttaccttcaccattgaccca
gtccgcgatcttctcatttgggccatcatccagaaccacagggagctggcgggcatcatc
tgggctcagagccaggactgcacagcagccgcactggcctgcagcaagatcctgaaggag
ctgtccaaggaggaggaagatacagacagctctgaggagatgctggcactcgcggatgag
tttgagcatagagctatcggtgtcttcaccgagtgctacagaaaggatgaggaaagagcc
cagaagctgcttgtccgtgtgtctgaggcctgggggaagaccacctgcctgcagctggcc
ctcgaggccaaggacatgaaattcgtgtctcacggagggatccaggctttcctaacgaag
gtgtggtggggtcagctctgcgtggacaatggcctgtggaggatcatcctgtgcatgctg
gccttccctctgctcttcaccggcttcatctccttcagggaaaagaggctgcaggcactg
tgccgcccggcccgcgtccgcgccttcttcaacgcgccggtggtcatcttctacctcaat
attctctcctactttgccttcctctgcctgtttgcctacgtgctcatggtggacttccag
ccctcaccatcctggtgcgagtacctcatctacctgtggctcttctccctggtgtgcgag
gagacacggcagctattctacgatcccgatggctgcgggctcatgaagatggcgtccctg
tacttcagtgacttctggaacaaactggacgttggggccattctgctctttatagcagga
ctgacctgccgactcatcccagcgacgctgtaccctgggcgcatcatcctgtctttggac
ttcattatgttctgcctccgcctcatgcacatcttcaccattagcaagacactggggccc
aagataatcatcgtgaagcggatgatgaaggacgtcttcttcttcctctttctcctggcg
gtgtgggtggtgtccttcggagtggccaagcaggccatcctcatccacaatgagagccgc
gtggactggatcttccgcggagttatctatcactcttaccttaccatcttcgggcagatc
ccgacctacattgacggcgtgaatttcagcatggaccagtgcagccccaatggtacagac
ccctacaagcccaagtgtcctgagagtgactggacagggcaggcacccgccttccccgag
tggctgacagtcacccttctctgcctctacctgctcttcgccaacatcctgctgcttaat
ttgctcatcgccatgttcaactacaccttccaggaggtgcaggagcacacagaccagatc
tggaagttccagcgccacgacctgattgaggagtaccacggccggcccccggcccctccc
ccactcatcctcctcagccacctgcagctcctgatcaagaggattgtcctgaagatcccc
gccaagaggcacaagcagctcaagaacaagctggagaagaatgaggaggcagccctcctg
tcctgggagctctacctgaaggagaattacctgcagaaccaacagtaccagcacaaacag
cggccagagcagaagatccaggacatcagtgagaaagtggacaccatggtggatctgttg
gacatggaccgtgtgaagagatcaggctccacagagcagaggctggcctcccttgaggaa
caggtgactcagatgggcagatctttgcactggatcgtgacgaccctgaaggacagtggc
tttggctcaggggccggtgcactgaccctggcagcccaaagggccttcgacgagccagat
gctgagctgagtatcaggaagaaaggagaggagggaggagatggctatcatgtgagcgcc
cggcacctcctctaccctgatgcccgcatcatgcgcttccccgtgcctaatgagaaggtg
ccttgggaggcagagtttctgatctacgaccctccgttttacacagctgagaagaaggat
gcgactctcacagaccctgtgggagacactgcagaacctctgtctaagatcaattacaac
gtcgtggacggactgatggaccgttgcagcttccatgggacctatgtggtccaatatgga
ttccctttgaaccccatgggccgcaccgggttgcgtggtcgtgggagcctcagctggttt
ggtcccaaccacactctgcagccagttgttacccggtggaagaggaaccagggtggaggc
atctgccggaagagtgtcaggaagatgttggaggtgctggtcatgaagttgcctcaatcc
gagcactgggccttgcctgggggctctcgggagccagggaagatgctaccacggaagctg
aaacaggtcctccagcaggagtactgggtgacctttgagaccttgctaaggcaaggtaca
gaggtgtacaaaggatacgtggatgacccaaggaacacggacaatgcctggatcgagacg
gtggctgtcagcatccatttccaggaccagaatgatgtggagctgaagaggctggaagag
aacctgcaaactcatgatccaaaggagtcggcccgtggcttggagatgtctactgaatgg
caggttgtagaccggcggatccctctgtatgtgaaccacaagaagatcctccaaaaggtg
gcctcgctgtttggcgctcacttctga

DBGET integrated database retrieval system