KEGG   Rattus norvegicus (rat): 294331
Entry
294331            CDS       T01003                                 

Gene name
Ube2g2
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 G2
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    294331 (Ube2g2)
   04120 Ubiquitin mediated proteolysis
    294331 (Ube2g2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    294331 (Ube2g2)
   05022 Pathways of neurodegeneration - multiple diseases
    294331 (Ube2g2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    294331 (Ube2g2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     294331 (Ube2g2)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   294331 (Ube2g2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 294331
NCBI-ProteinID: NP_001099850
RGD: 1304860
Ensembl: ENSRNOG00000001222
UniProt: B2RYD0
Position
20
AA seq 165 aa
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggggacggcgttgaagaggctgatggccgaatataagcaattaaccctgaatcct
ccagaaggaattgtggcaggccccatgaatgaagagaatttttttgaatgggaggcattg
atcatgggccctgaagacacttgctttgagtttggtgttttccccgccatcctgagtttc
ccacttgactaccctttgagccctccgaaaatgagattcacctgtgagatgttccatccc
aacatctaccctgacggaagagtgtgcatctccatcctgcatgccccaggggacgacccc
atgggctatgagagcagtgccgagcggtggagcccagtgcagagtgtggagaagatcctg
ctttcggtggtgagcatgctggcagagcccaatgatgagagtggagcaaacgtagacgct
tccaagatgtggcgggacgaccgtgagcagttctacaagattgccaagcagatcgtacag
aagtctctggggctctga

KEGG   Rattus norvegicus (rat): 297961
Entry
297961            CDS       T01003                                 

Gene name
Ube2j1
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 J1
  KO
K10578  ubiquitin-conjugating enzyme E2 J1 [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    297961 (Ube2j1)
   04120 Ubiquitin mediated proteolysis
    297961 (Ube2j1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    297961 (Ube2j1)
   05022 Pathways of neurodegeneration - multiple diseases
    297961 (Ube2j1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    297961 (Ube2j1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     297961 (Ube2j1)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   297961 (Ube2j1)
SSDB
Motif
Pfam: UQ_con RWD ATPase-cat_bd
Other DBs
NCBI-GeneID: 297961
NCBI-ProteinID: NP_001100112
RGD: 1305067
Ensembl: ENSRNOG00000007434
Position
5
AA seq 249 aa
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHG
RIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMP
TKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGIDSSQADQEAKELA
RQISFKAEVNSSGKTIAESDLNQSFSLNDSQDDYLQHSRVLQQAHRMAPRIHQEHPCHNL
PSQLLRIPP
NT seq 750 nt   +upstreamnt  +downstreamnt
atggagacccgctataacctgaagagcccggctgttaaacgattgatgaaagaagccgca
gaattgaaagatccaacagatcattaccacgctcagcctctggaggataacctttttgaa
tggcacttcacagttagagggcccccagattccgattttgatggaggagtttatcatgga
cgcatagtactgccaccagagtaccccatgaaaccacccagcattattctgctgacggct
aatggacgatttgaagtgggcaagaagatctgtttaagcatctcaggacatcatcctgag
acctggcagccttcatggagcataaggacagccctgctggccatcattgggtttatgcca
actaaaggagagggagccataggttctctagactacacgcccgaggagaggagagcactt
gccaagaaatcacaagacttctgttgtgagggctgtggctctgccatgaaggatgtcctg
ttgcctttaaaatctggaatcgattcaagccaggctgaccaagaagccaaagaactggct
agacaaattagttttaaggccgaagtcaattcatctggaaagactatcgctgaatcagac
ttaaaccagtctttctcactaaatgattcacaagacgattacctacaacattccagggtg
ctgcagcaagcacatcgtatggcgcccagaatccatcaggagcacccttgccacaaccta
cccagccagctcctaagaatacctccatga

KEGG   Rattus norvegicus (rat): 298689
Entry
298689            CDS       T01003                                 

Gene name
Ube2j2
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 J2
  KO
K04554  ubiquitin-conjugating enzyme E2 J2 [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    298689 (Ube2j2)
   04120 Ubiquitin mediated proteolysis
    298689 (Ube2j2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    298689 (Ube2j2)
   05022 Pathways of neurodegeneration - multiple diseases
    298689 (Ube2j2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    298689 (Ube2j2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     298689 (Ube2j2)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   298689 (Ube2j2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 298689
NCBI-ProteinID: NP_001007656
RGD: 1359523
Ensembl: ENSRNOG00000019749
UniProt: Q6AYB7 A0A0G2K8C5
Position
5
AA seq 271 aa
MHQAKALDSARKMSSNSNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVV
RGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPA
WSVSTILTGLLSFMVEKGPTLGSIETSDFTKKQLAAQSLVFNLKDKVFCELFPEVVEEIK
QKQKAQDELSNRPQNLPLPDVVPDGEMHRGQNGIQLLNGHAPAAGPNLAGLPQANRHHGL
LGGALANLFVIVGFAAFAYTVKYVLRSIAQE
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcatcaggcaaaagcccttgattctgccagaaagatgagcagtaacagcaataagaga
gctccaacaactgcgacacaaaggttgaaacaggactaccttcgaattaagaaagaccca
gtgccttacatctgtgcggagcccctcccttcaaatattcttgaatggcattatgttgtc
cgaggccctgagatgactccttatgaaggtggctattatcatggaaaactaatttttccc
agagaatttccatttaagcctcctagtatttacatgataacccccaatggaagatttaag
tgcaacacaaggctgtgtctctccatcacagatttccatccagatacatggaatccagcg
tggtccgtctccaccattctaacagggctcctgagctttatggtggagaaaggccccacc
ctggggagcatagagacatcggacttcacgaaaaaacagctggcagcacagagtctagtg
tttaatttaaaagataaagtcttctgtgaattatttcctgaagttgtggaggaaattaaa
cagaaacagaaagcacaagatgaactaagtaacaggccccagaatcttcctttgccagac
gtggttcctgatggggagatgcaccgtggccagaatgggatccagctcctcaatgggcat
gcacctgctgctggcccaaaccttgctgggctcccacaggccaacaggcatcatggactc
ctgggcggcgctttggcgaacttgtttgttatagttgggtttgcggcctttgcctacacg
gtcaaatacgtgctgagaagcatagcacaggagtga

KEGG   Rattus norvegicus (rat): 64631
Entry
64631             CDS       T01003                                 

Gene name
Ube2g1
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 G1
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    64631 (Ube2g1)
   04120 Ubiquitin mediated proteolysis
    64631 (Ube2g1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    64631 (Ube2g1)
   05022 Pathways of neurodegeneration - multiple diseases
    64631 (Ube2g1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    64631 (Ube2g1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     64631 (Ube2g1)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   64631 (Ube2g1)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 64631
NCBI-ProteinID: NP_073181
RGD: 620392
Ensembl: ENSRNOG00000010041
UniProt: P62255
Position
10
AA seq 170 aa
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT
FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI
MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagctgcagtcggcactgctactgcgaagacagctggcagaactcaacaaaaat
ccagtggaaggcttttcagcaggtttaatagacgacaatgatctctatcgttgggaagtc
cttattattggtcctccagatacactttatgaaggtggtgtttttaaggctcatctcact
ttcccaaaagattatcccctccgacctcctaaaatgaaattcattacagagatttggcac
ccaaatgttgataaaaatggtgatgtttgcatttctattcttcatgaacctggagaggat
aaatatggttatgagaagccagaggaacgctggctgcctatccatactgtggaaaccatc
atgattagtgtcatttctatgctggcagatcctaatggagactcacctgcaaatgtagat
gctgcgaaagaatggagggaagacagaaatggagaatttaaaaggaaagttgcccgctgt
gtaagaaaaagccaagaaactgcttttgagtga

DBGET integrated database retrieval system