KEGG   Rattus norvegicus (rat): 29434Help
Entry
29434             CDS       T01003                                 

Gene name
Rasgrp1, Rasgrp
Definition
(RefSeq) RAS guanyl releasing protein 1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04611  Platelet activation
rno04660  T cell receptor signaling pathway
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29434 (Rasgrp1)
   04010 MAPK signaling pathway
    29434 (Rasgrp1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29434 (Rasgrp1)
   04660 T cell receptor signaling pathway
    29434 (Rasgrp1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    29434 (Rasgrp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 RasGEF_N EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 bZIP_1 SPARC_Ca_bdg CENP-F_leu_zip ACDC DUF2968
Motif
Other DBs
NCBI-GeneID: 29434
NCBI-ProteinID: NP_062084
RGD: 3539
Ensembl: ENSRNOG00000005404
UniProt: Q9R1K8
Position
3q35
AA seq 795 aa AA seqDB search
MGTLGKAREAPRKPCHGSRAGPKGRLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIIISSAELLQKLMNLYKDALEKNSPG
ICLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEESHCHLIDTTQINSRDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQDVAPPLDANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRSKSPAV
STENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEVVDHSEESKDRTIMLLGVSSQKI
SVRLKRTVAHKTTQTESFPWVGGEMPPGHFVLTSPRKSAQGALYVHSPASPCPSPALVRK
RAFVKWENKESLIKPKPELHLRLRTYQELEQEVNTLRADNDALKIQLKYAQKQIESLQLG
KSNHVLAQMDHGDGT
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccctgggcaaggcgagagaggctccgcggaaaccttgccatggctccagagct
ggccccaaaggaagactagaggccaaatcaaccaacagtcctctccctgcccagcccagc
ttggcccagatcacccagttccgaatgatggtgtccctgggacatctggccaaaggagcc
agcctggatgatcttattgacagctgcattcaatctttcgatgcagatggaaacctgtgt
cgaagtaaccagctgttacaagtcatgctaaccatgcaccgaatcatcatctcctcggcc
gagctgctgcaaaaactcatgaatctatataaggacgccctggaaaagaattctccagga
atttgcttgaagatctgctattttgtcaggtattggataacagaattctggatcatgttc
aaaatggatgccagcttgaccagcaccatggaagagtttcaggacctggtgaaagccaat
ggtgaggagtcccactgccacctcatcgacacgacacaaattaattctcgagactggtcc
aggaaactgactcagaggataaaatcaaataccagcaagaagcggaaagtgtccctgctg
tttgaccatcttgaacctgaagaactgtctgaacacctcacctaccttgagttcaagtcc
ttccgacggatatctttctctgattatcagaattaccttgtaaacagctgcgtaaaggag
aaccccaccatggagcggtccattgccctgtgcaatggcatctcccagtgggtacaactg
atggttctcagccgtcccaccccacagctccgggcagaggtcttcatcaagttcatccat
gtggctcagaagctccaccagctacagaacttcaacacgctaatggctgtgatcggggga
ctgtgtcacagctccatctccaggctcaaggagacaagttcacatgtcccacatgagatc
aataaggttctgggtgagatgactgaactgctgtcctcctgcagaaactatgacaactac
aggcgagcctatggtgagtgcacccacttcaaaatccccatactgggtgtgcacctcaag
gacctcatatccctatatgaagccatgcctgactacctggaagacgggaaggtgaatgtc
caaaagctcctggccctttacaatcacatcaatgagttggtccagctgcaggacgtggcc
ccaccattggatgccaacaaggacctggtgcacctgctgacgttatccctggatctatac
tacaccgaagatgaaatctatgagctttcctacgcccgtgaaccaaggaaccacagggcc
ccgccactgacaccttcgaagccaccagttgtagtggactgggcctctggagtgtctccc
aaacctgacccgaagaccatcagcaaacacgtccaaaggatggtggattctgtctttaag
aactatgatctcgaccaggatggatatatctctcaggaggagtttgaaaagattgctgcg
agctttccattttccttctgtgtgatggacaaagatagggagggcctcatcagcagagac
gagatcacagcctacttcatgagggccagctccatctattccaagctgggcctaggcttt
ccacacaactttcaagagaccacttacctgaagcccaccttctgtgacaactgtgctggc
tttctctggggtgtgatcaagcaaggctatcgctgtaaagactgtgggatgaactgccac
aaacagtgcaaagacctggtagtgtttgagtgcaagaaacgatccaagagcccggcggta
tccacagaaaacatcagctctgtggtgccaatgtccactctttgtccactgggaaccaaa
gatctgctccatgcacccgaagaaggatctttcattttccagaatggagaggttgtggac
cacagtgaggagagcaaggataggaccatcatgctcttgggcgtatcctcacagaaaatt
tcagttcggctgaagaggactgttgcccacaagaccacccagacagaatcatttccttgg
gttggcggcgagatgccccctggtcactttgtgctgacttctccaagaaagtcagcacaa
ggggctctttatgtgcacagtccagcatctccgtgccccagcccagcactggtccggaag
cgggcattcgtcaagtgggagaacaaagagtcccttatcaaaccaaaaccagagcttcac
ctcaggctccggacctaccaagaactggaacaggaggtaaataccctgagggcagataac
gatgctctgaagatccagctgaagtatgcacagaaacaaatagaatccctgcagcttggc
aaaagcaatcacgtcttagcacagatggaccacggtgatggtacttaa

DBGET integrated database retrieval system