KEGG   Rattus norvegicus (rat): 29436
Entry
29436             CDS       T01003                                 

Gene name
Tfpi
Definition
(RefSeq) tissue factor pathway inhibitor isoform 1 precursor
  KO
K03909  tissue factor pathway inhibitor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    29436 (Tfpi)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29436 (Tfpi)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29436 (Tfpi)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   29436 (Tfpi)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   29436 (Tfpi)
SSDB
Motif
Pfam: Kunitz_BPTI
Other DBs
NCBI-GeneID: 29436
NCBI-ProteinID: NP_058896
RGD: 61914
Ensembl: ENSRNOG00000005039
UniProt: Q02445
Position
3
AA seq 302 aa
MTNKLKKDHAFWAAVCLLLSIVPELLNALPEEDDDTINTDSELRPMKPLHTFCAMKAEDG
PCKAMIRSYYFNMNSHQCEEFIYGGCRGNKNRFDTLEECRKTCIPGYKKTTIKTTSGAEK
PDFCFLEEDPGICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTCEDPVNE
VQKGDYVTNQITVTDRTTVNNVVIPQATKAPSQWDYDGPSWCLEPADSGLCKASEKRFYY
NPAIGKCRQFNYTGCGGNNNNFTTKQDCNRACKKDSSKKSSKRAKTQRRRKSFVKVMYEN
IH
NT seq 909 nt   +upstreamnt  +downstreamnt
atgactaacaaactgaagaaagaccacgccttctgggcggctgtgtgtctgctgcttagc
attgttcctgagcttcttaatgctctgcccgaggaagacgatgatacaataaacacagat
tccgagctgcggccaatgaaaccgttgcatacattctgtgcaatgaaggcggaagacggg
ccctgcaaagcaatgatacggagttattatttcaatatgaacagtcaccagtgtgaagaa
tttatatacgggggatgcagaggaaacaagaaccgatttgatactctggaagagtgtagg
aaaacatgcataccaggttataaaaagacaactataaagacaacatctggagcagaaaag
ccagatttctgcttcttggaagaggatcctggaatctgccgaggtttcatgaccaggtat
ttttataacaaccagtcaaagcagtgtgaacaattcaagtacggcggttgcctgggcaac
agcaacaactttgagaccttggaggagtgcaggaacacctgtgaggatccagtgaatgag
gtacagaagggtgactacgtaactaatcaaattactgtaactgatcgcactactgtaaat
aacgtggtgattcctcaggctaccaaagcgcccagccaatgggactatgatggcccttca
tggtgtcttgaaccagcagacagtggattatgtaaagccagtgagaaaagattctactac
aacccagccattgggaaatgccgtcaatttaactacactggatgtgggggaaataataat
aattttactaccaaacaagattgtaatagagcatgtaaaaaagattcctccaaaaaaagc
tcaaaaagagcaaagacccaaagaagaaggaagtctttcgtgaaagtcatgtacgaaaat
attcattag

DBGET integrated database retrieval system