KEGG   Rattus norvegicus (rat): 294388Help
Entry
294388            CDS       T01003                                 

Gene name
Stox1, RGD1310622
Definition
(RefSeq) storkhead box 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Stork_head
Motif
Other DBs
NCBI-GeneID: 294388
NCBI-ProteinID: NP_001178649
RGD: 1310622
Ensembl: ENSRNOG00000023712
UniProt: F1M4Y5
Position
20q11
AA seq 978 aa AA seqDB search
MARPVQLAPGSLALVLSPREAGQAAGEPGGRALFRAFRRANARCFWNARLARAASRLAFL
GWLRRGVLLVRAPQPCVQVLRDAWRRRALRPPRGFRITAVGDVFPVQMSLIAQRRFVPLA
EVLCCVIADMNAGQVAVTQEALLEHLMKHYPGIAVPSPDILYSTLGTLIQQRKIYHTGEG
YFIVTPNTYFITNTTMQGNKRALLSDEGCSGSTSGTYLVSVDSCAEPTQENEVPVSHCPS
CQCYPDTSKHGSKDLMTTAEVSRKRQNGLDKPTVLTKNQVVSASEDTHICVSPKPSSYTK
DKGKRFGFGFLWRSLSRKEKPKAGYHSFSAQFPPEEWPVRDEDSSNNIPRDVEHAIIKRI
NPVLTVDNLTRHTALMQKYEEQKKHNSQGTSTDVLPSRHKYSSKEATRRRQGQAAKPHKR
SCSHKGRQKAWSQTRELEPGSPEQEKEKNPKVPAAQPAASTKSPSERVHHLHGRNPAVLG
SHLIYKKQINNPFQGMHLRGHPASKGYIVQKTHKPSCIGPEEKPFRRAGFSGPSRVFDGE
AQPPCLEHCRDKLEAETTHVAKAPIHPVSDDFRGGPGNYPPHRVLTSHSRCCSFRESTLR
AAVYHEENKVLPEVLRKSWSDCDMFLGTKEKKQVLPAQRSSLDPDSSVYAEDKTVDKTVH
QFQNLGLLDCPVGANRLRTHERQDGDSEKLSRKAFQIPEAEIVNMEEEGLSDSEQDEVAL
SQSDPGAGDDGGCSSLCLEDDFSETDDFCHTLPGYTQYSFAAGNSWNHLGRPTMTGRSLT
DCNSKTHRLEPLGIERNHWYKATGSFSNARESPNPDLADNPGLNSEIPPGFNYEGEPVVA
HVQTPAAAGQSLLERSIVREASLPVEILQDSPGDRGENPAVWRQSLPSQEMKKHFTDKLQ
LVKTSHVPALAHLEGTENSSMAGDSGIDSPRTQSLVSTNSAMLDGFKRQNFLQTGESVQK
SQKLASNSLLRLTPAINV
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atggcacggccggtgcagctggcgccgggctcgctggcgctggtgctgagcccgcgggag
gccgggcaggcggccggggagccgggcggccgcgcgctcttccgcgccttccgccgcgcc
aacgcgcgctgcttctggaacgcacggctggcgcgcgccgcctcgcggctggcctttctc
ggctggctgcggcgcggggtgctgctggtgcgcgcgccccagccctgcgtgcaggtgctg
cgggatgcgtggcgtcgccgagctctgaggccgccccgaggtttccgcatcaccgcggtg
ggcgatgtcttcccagtgcaaatgagtctcatagcccagcgtcgctttgtgcccttggct
gaagttctctgctgtgttatagccgatatgaacgcaggtcaggtggctgtgacacaggag
gctctcttggagcacttgatgaaacattatccaggtattgctgttccctccccagacatt
ctctacagcacactggggactctaattcaacagaggaagatttaccacactggagaaggc
tacttcatagttaccccaaacacgtacttcatcacaaatacaaccatgcaaggaaataag
agagccctcctgtcagatgaagggtgctcagggtccacgtcagggacctatctggtgagc
gtggatagctgtgcagagcccacccaggagaacgaggttcctgtttcccactgcccatca
tgccagtgttaccctgatacaagcaagcatggctctaaggacctaatgactactgcagaa
gtctctagaaaaagacagaacggtcttgacaagcccacagtcttgactaagaatcaggta
gtttcagcatctgaagacacccacatctgtgtgagccccaaaccatcatcatacaccaag
gacaaaggcaaaagatttggtttcggtttcttgtggcgcagcttatctagaaaagagaag
cccaaggcggggtatcacagtttctctgcacagttcccacccgaagagtggcctgtccga
gacgaggacagttccaacaacatcccccgagacgtggaacatgcaataatcaaaaggatt
aaccctgtactgactgttgacaacttaaccaggcacaccgccctaatgcaaaaatatgaa
gaacagaaaaaacataacagccagggcacgtcaacggatgtactgccaagcaggcataag
tattcctcgaaagaggcaactcggagaaggcagggccaggcagccaagccccacaagcgg
agctgttctcataagggtagacagaaagcatggagccagacacgtgagcttgagcctgga
agccctgaacaggaaaaggaaaagaaccccaaggtccctgcagcccagcctgctgcgagc
acaaagagccccagtgaacgagttcatcacttgcatggtaggaatccagctgtgctaggt
tcccacttgatttataaaaagcagatcaacaatccgtttcagggcatgcatctccgaggg
caccccgcatccaaagggtacatcgttcagaagacccacaaacctagttgcatcgggcca
gaggaaaagcctttccggagggcaggcttttctggtccttccagagtctttgatggtgaa
gcccaacctccatgtctggaacattgccgtgataaactggaagcagaaaccacgcatgtg
gcgaaggctcctatccatccagtcagcgacgatttcagaggtggcccaggaaattatcct
ccacatagagttttgacaagccactctcggtgctgttccttcagggaaagtacgctgcga
gctgctgtgtatcacgaggaaaacaaggtcctccctgaagtcttgaggaaaagttggtcc
gactgtgacatgttcttagggaccaaggaaaagaagcaggtcctgcctgcacaacgtagc
tctttagacccagactcctctgtgtatgcagaggataagacagtggataagacagtacac
cagttccaaaacctcggcctcttagattgcccagttggtgcaaaccgtttgaggactcat
gaaagacaagatggcgactcagaaaaactaagtaggaaggcgtttcaaatcccagaggcg
gagattgtgaatatggaagaggaggggctttctgacagtgagcaggacgaggtggccttg
agtcagagtgaccccggggctggggatgatgggggctgcagttctctgtgtttagaggat
gacttctctgagacagatgatttctgtcacacactgcctggatacacccagtactccttt
gccgctggaaactcgtggaatcatttgggaagaccaaccatgactggaagatctctgact
gactgtaatagcaaaacccataggcttgagcctctagggattgaaaggaatcactggtac
aaggccacagggtcgttttcaaatgccagggaaagcccaaaccctgatctcgctgacaac
cctggcctaaattcagagattcctccgggtttcaactacgaaggagagcccgttgttgcc
catgtccagaccccagcagctgctggccaaagtttacttgagcgttctattgtaagggag
gccagtctcccggttgagatcctgcaagattctcctggtgataggggggagaatccagct
gtctggagacagagccttccaagtcaggaaatgaaaaagcatttcacagacaagttacag
cttgtcaagacctcacacgtgccagcgttggctcacctggaaggcacggagaattccagc
atggcgggagacagtgggattgattcccccaggacgcagagcctggtgtctactaattca
gccatgttggatggatttaaaagacagaattttcttcagactggggaaagcgttcagaag
agccaaaaacttgcatcgaattccttgttgcgactaactccagctataaatgtctaa

DBGET integrated database retrieval system