KEGG   Rattus norvegicus (rat): 29439Help
Entry
29439             CDS       T01003                                 

Gene name
Jtb
Definition
(RefSeq) jumping translocation breakpoint
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: JTB DUF1505
Motif
Other DBs
NCBI-GeneID: 29439
NCBI-ProteinID: NP_062086
RGD: 2942
Ensembl: ENSRNOG00000016379
UniProt: O88823
Position
2q34
AA seq 146 aa AA seqDB search
MLVGAGRRGLPRGGHLCWLLCAFTLKLCEAEAPVREEKLSVSTSTSPCWLVEEFVVTEEC
TPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGIVVGVALVF
ACLVIIRQRQLDRKALEKVRKQIESI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgggcgcggggaggcgtggcctcccccggggcggccacctctgttggttgctg
tgcgctttcaccttaaagctctgcgaagcagaggccccggtgcgcgaggagaagctatca
gtgagcacatcaacttcaccatgttggttggtagaagagtttgtggtgaccgaagagtgt
actccgtgttctaacttccagattaaaacgacacctgagtgtggttctacagggtatgtg
gagaaaatcacatgcagctcatctaagaggaatgaattcaaaagctgccgttcagctctt
ctggaacaacacttattttggaagtttgaaggcatcgtggtgggggtagctttagtcttc
gcttgccttgtcatcattcgtcagcgacagctggacagaaaggctcttgaaaaagtccgg
aagcaaattgaatccatatag

DBGET integrated database retrieval system