KEGG   Rattus norvegicus (rat): 294390Help
Entry
294390            CDS       T01003                                 

Gene name
Zufsp, RGD1307672
Definition
(RefSeq) zinc finger with UFM1-specific peptidase domain
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C78 zf-Di19 Peptidase_C54 DDRGK COX16
Motif
Other DBs
NCBI-GeneID: 294390
NCBI-ProteinID: NP_001008309
RGD: 1307672
Ensembl: ENSRNOG00000000398
UniProt: Q5U2S3
Position
20q11
AA seq 577 aa AA seqDB search
MLSCDICGETVTSEPDRKAHLIVHMENEIICPFCKLSGINYNEMCFHIETAHFEQTTPEK
SFETLAAVQYENSDLGNTKLHSTVEVTSGIHSACASNFPKESSESLSKDRTLKQEAFYTE
SVAESRKYQKSREKQSGLSEAQGSIYETTYSPPECPFCGRIERYSQDMEIHVKTKHASLL
ESPLEDCHQPLYDCPMCGLVCTNYHILQEHVDLHLEESSFQQGMDRVQCSSDRELAHQLQ
QEEERKRKSEESRQEREEFQKLQRQYGLDNSGGYKQQQLRHMELEVTRGRMHPSEFHSRK
ADMLESIAVGIDDGKTKTSGIIEALHRYYQNIATDVRCVWLSTVVDHFHSSFGDKGWGCG
YRNFQMLLSSLLQNEVYSDCLKGMSVPCIPKIQSMIEDAWNEGFDPQGASQLNNKLQGTK
AWIGACEIYTLLTSLKVKCRIIDFHKSTGPSGTHPRLFEWILNYYSSETEGAPKVVCTSK
PPVYLQHQGHSRTVVGIEERKNRTLCLLIFDPGCPSREMQKLLKQDMEAGSLRQLRKCVG
NLKHKQYQIVAVEGILSPEERAARKQASQVFTAEKIP
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgctttcctgtgacatctgtggtgaaactgtaacctcagaaccagataggaaggctcac
ctaattgttcacatggaaaatgaaattatctgtccgttttgcaagctgtcgggtataaat
tacaatgaaatgtgttttcatattgaaaccgctcattttgaacagactacgccagaaaaa
agcttcgagacgctagccgcagtgcaatatgaaaattcagacctcggtaataccaagctg
cacagtacagtggaagttacctcaggcatccattcagcttgtgcatcgaactttccaaag
gagtcgtccgaaagcctttctaaagataggactttaaaacaagaagctttttatacagag
agcgtagctgaatctagaaagtaccagaaaagcagagaaaagcagtccggattgtctgag
gcccaaggatcaatttatgaaacaacatacagtccccccgaatgtccgttctgtgggaga
attgagaggtacagtcaagatatggaaattcatgtgaaaacaaagcatgccagccttcta
gaaagtccgttagaagactgtcatcaaccactctatgactgtcccatgtgtgggcttgtc
tgtacaaattatcacattctccaagaacatgtggacttgcatttagaagaaagcagcttt
caacaaggcatggacagagtccagtgttctagtgacagagaattagctcaccagcttcag
caagaagaagagagaaagaggaaatctgaagaatcaagacaagaaagggaagagtttcag
aaattgcagcggcagtacggcttagataattctggaggatacaaacaacagcagctgcga
cacatggagctagaagtaacgaggggacgaatgcatccatctgagttccacagcagaaaa
gctgacatgttggaatcaatcgctgttggtattgatgatggaaaaacaaaaacttctgga
attattgaagccctccacaggtattatcagaacattgccacagatgtaaggtgtgtgtgg
ctgtctacagtggtggatcactttcattcatcttttggggacaaaggttggggttgcggt
tatagaaatttccagatgctgctttcatcattactgcagaatgaagtgtacagtgactgc
ttgaaaggtatgtcagttccttgtattccaaaaattcagtccatgattgaagatgcgtgg
aatgaaggttttgatcctcagggggcctctcaacttaataacaagttgcaggggaccaag
gcctggattggagcatgtgagatctatacacttctgacctcactgaaagtcaagtgccgc
attattgattttcacaagtcaactggtccttcaggcacacaccctcgcttattcgagtgg
atactgaactattattcctcagagacggaaggggcgccaaaggtcgtgtgtacatccaaa
cctcctgtctatctccagcatcagggtcacagtcgaacagttgttgggattgaagagaga
aaaaaccgaacattatgtttgctaatatttgatcctggatgtccttctcgagaaatgcag
aagctgttaaagcaagacatggaggctggtagtctcaggcagctccggaaatgtgtggga
aatctgaagcataagcagtaccagatagtagcagtggagggtatcctgtccccagaggag
agagctgccaggaaacaagcttctcaagtgtttacagcggagaagattccttga

DBGET integrated database retrieval system