KEGG   Rattus norvegicus (rat): 294392
Entry
294392            CDS       T01003                                 

Gene name
Kpna5, Ipoa6
Definition
(RefSeq) karyopherin subunit alpha 5
  KO
K15042  importin subunit alpha-6/7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    294392 (Kpna5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    294392 (Kpna5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    294392 (Kpna5)
SSDB
Motif
Pfam: Arm IBB HEAT_EZ Arm_3 HEAT_2 HEAT V-ATPase_H_C RICTOR_V Adaptin_N
Other DBs
NCBI-GeneID: 294392
NCBI-ProteinID: NP_001020284
RGD: 1561324
Ensembl: ENSRNOG00000030109
UniProt: Q56R16
Position
20q11
AA seq 536 aa
MASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVSLPRNDDCML
ESPIQDPDVSSTVPIPEEDMITADMIQMIFSNNAEQQLTATQKFRKLLSKEPNPPIDQVI
QKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIRLLTSEH
EDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRG
KNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQVVIDSGVCRRLV
ELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLGSPKESVRKEACWTI
SNITAGNRMQIQAVIDGSIFPVLIEVLQKAEFRTRKEAAWAITNATSGGAPEQIRYLVTL
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGERESKQNGVGINPYCALIEEAYGLDKIE
FLQSHENQEIYQKAFDLIERYFGVEEDDPSLVPQVDEQQRQFLFQQCEAPGEGFQL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggctagtcctggtaaggataactacagaatgaaaagttacaagaacaaagccttaaat
cctcaagagatgcgaagacgaagagaagaagaaggaatacaacttcgaaaacaaaaaagg
gaggagcagttgttcaaacgcagaaatgtctctttgcccagaaatgatgactgtatgctg
gagagccctatccaggacccagatgtcagctccactgtacccattccagaggaagacatg
atcacagcagatatgattcagatgattttctctaataacgctgaacagcaactgactgca
acacagaaatttagaaaactgctttctaaagaacccaatccaccaatagatcaagttata
cagaaaccaggagttgtacagagatttgtgaagtttcttgaaagaaatgaaaattgcact
ttacaattcgaggctgcctgggcgttaactaatatagcatctggaacttttctgcatacc
aaggtagtgattgaaaccggggctgtgccaatttttatcagacttctcacttcagaacat
gaagatgtacaggaacaggcggtttgggcacttggtaacattgctggcgacaatgcagaa
tgcagggattttgttttgaattgtgaaatacttccacctcttttagagttattaacaaat
tcaaacagacttacaaccaccagaaatgctgtatgggccctctcaaatttatgtagaggc
aaaaaccctcctccaaattttagtaaggtttcaccttgcttaaatgtcttatcccggttg
ttgtttagcagtgatccagatgtgttagcagatgtgtgctgggccctttcttatctctct
gatggacccaatgataaaattcaagtagtcattgattctggagtctgccgaagattggtg
gaacttttgatgcacaatgactataaagttgtatcacctgcattaagagcagttggtaat
attgtaactggtgatgacattcaaacacaggtcattttgaattgttctgcattgccctgc
cttttacatttgctgggaagtccaaaggagtcagttagaaaggaagcctgctggaccatt
tctaacatcactgcgggaaacagaatgcagatccaggctgtcatagatggaagtattttc
cctgttttgattgaggtcctccagaaagcagaatttcgtaccagaaaagaagcagcgtgg
gctataaccaatgccacatcgggaggcgctccagagcagataaggtatttggtaaccttg
ggctgcattaaaccactttgtgaccttttgactgtcatggactccaaaatagttcaagtt
gctttgaatggacttgaaaatattttacgccttggagaacgagaatctaagcagaatgga
gtgggcatcaatccatactgtgctctcattgaagaagcgtacggcttggataaaatagag
tttctgcaaagtcatgaaaaccaggaaatttaccagaaggcttttgatctgattgaacgc
tattttggtgtggaggaggatgaccctagtctcgttcctcaggtggatgagcagcagcgg
cagtttctctttcagcagtgcgaggcaccaggagaaggcttccagctctga

DBGET integrated database retrieval system