KEGG   Rattus norvegicus (rat): 294400Help
Entry
294400            CDS       T01003                                 

Gene name
Nus1, RGD1307879
Definition
(RefSeq) NUS1 dehydrodolichyl diphosphate synthase subunit
  KO
K19177  dehydrodolichyl diphosphate syntase complex subunit NUS1 [EC:2.5.1.87]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    294400 (Nus1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     294400 (Nus1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-GeneID: 294400
NCBI-ProteinID: NP_001157629
RGD: 1307879
Ensembl: ENSRNOG00000000411
UniProt: D3ZFM4
Position
20q11
AA seq 293 aa AA seqDB search
MTGLYELVWRVLHLLFCLYRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKLP
AVGRNRRHHRHPHRGPGPAATHPRLRWRADGRSLQKLPVHMGLVITEEVQEPSFSDIASL
VVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQ
VLNCPSAVKVLSPEDGKADIVRAAQDFCQSVAQQQRRPTELGVELLDSLLSSHGFPDPDL
VLKFGPVDSTLGFLPWQIRLTEIISLPSHSNISYEDLFSALRQYAACEQRLGK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacggggctgtacgagctggtgtggcgggtgctgcacttgctgttctgcctgtaccgc
acgctcacctcctggctccgcgttcgcttcggcacatggaactggatctggcggcgctgc
tgtcgcgccgcctccgccgcggtcctagcgccgctcggcttcacgctccgcaagctcccg
gccgtcggcaggaaccggcgtcatcaccggcacccgcaccggggaccgggaccggccgcc
acccacccccggctgcgctggcgcgcggacggccggtccctgcagaagctgccggtgcac
atgggcctggtgatcaccgaggaagtgcaagagcccagcttctcagacatcgccagcctc
gtggtgtggtgtatggccgtggggatctcctacattagcgtctacgaccaccaaggtatt
ttcaagagaaataattccagattgatggatgaaattttaaaacaacagcaggaacttttg
ggccaagattgttccaaatactcagcagagtttgcaaatagtaacgacaaagacgatcaa
gttttaaattgcccatcggcggtgaaggtgctgtccccagaagacggaaaagccgacatt
gtgcgagccgcccaggacttttgccagtcagtagcccagcagcagaggaggccgacggag
ctgggtgtagagctgctcgacagcttactgagttcacatggcttccctgatcctgactta
gtgttgaagtttggtcctgtggacagcacgttaggctttcttccctggcaaatcagattg
actgagatcatctctttgccttctcactcaaacatcagctatgaggaccttttctccgcc
ctccggcagtatgcagcttgtgaacagcgtctggggaagtaa

DBGET integrated database retrieval system