KEGG   Rattus norvegicus (rat): 294421Help
Entry
294421            CDS       T01003                                 

Gene name
Serinc1, LRRGT00191, Tde1l, Tde2
Definition
(RefSeq) serine incorporator 1
  KO
K23544  serine incorporator 1/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    294421 (Serinc1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   Others
    294421 (Serinc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serinc
Motif
Other DBs
NCBI-GeneID: 294421
NCBI-ProteinID: NP_891996
RGD: 727843
Ensembl: ENSRNOG00000029360
UniProt: Q7TNK0
Position
20q12
AA seq 453 aa AA seqDB search
MGSVLGLCSVASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPG
MEEQLNKIPGFCENEKGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAA
VHNGFWFFKFATAVAIIIGAFFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNE
SWVEKMEEGNSRCWYAALLSATALNYLLSLVAIILFFVYYTHPASCSENKAFISVNMLLC
IGASVMSILPKIQESQPRSGLLQSSVITIYTMYLTWSAMTNEPETNCNPSLLSIIGFNTT
RPVPKDGQSVQWWHPQGIIGLVLFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGNGR
SDGSLDDGEGVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQW
TAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggggagcgttttggggctgtgctccgtggcgagctggattccctgtttgtgtggcagc
gccccgtgtttgctgtgccgatgctgtcctagtgggaacaactccactgtgactagattg
atctatgcacttttcttgcttgttggagtatgcgtagcttgtgtaatgttaataccagga
atggaagaacaactgaataagattcctgggttctgtgagaatgagaaaggtgttgttcct
tgtaatattctggttggctacaaagctgtgtatcgcctgtgctttggcctggccatgttc
tatcttctcctctctttactaatgatcaaagtgaaaagcagcagcgaccctagagccgcg
gtccacaacggattctggttctttaaatttgctacagcagttgcaattattattggcgca
ttcttcatcccagaaggcacttttacaactgtgtggttttatgtgggcatggcaggcgcc
ttttgcttcatccttatacaactagtcttacttattgactttgcccattcttggaatgaa
tcctgggttgaaaaaatggaagaagggaactcaagatgttggtatgcagccctgttgtca
gccaccgctctgaattacttgctgtctctggtcgccatcatcctgttctttgtatactat
actcacccagccagctgctcagaaaacaaggcgttcatcagtgtcaacatgctgctctgc
atcggcgcgtctgtaatgtccattctgcccaagatccaggaatcacaaccaagatctggc
ttgttacagtcttcagtaattacaatctacacaatgtatttgacatggtctgctatgact
aatgaaccagaaacaaactgcaatccaagtctgctgagcatcattggcttcaataccaca
agacctgtcccaaaggacgggcagtctgttcagtggtggcatcctcaaggaattatagga
ctcgttctcttcctgctctgtgtgttttattcgagcatccgtacctccaacaacagtcag
gttaataaactgactctaacaagtgatgagtcaacattaatagaggacgggaatggcaga
agtgacgggtcactagacgatggtgaaggcgtccaccgagctgtagataacgaaagggat
ggagtcacttacagttactccttctttcacttcatgctcttcctggcttcgctttacatt
atgatgacccttaccaactggtacaggtatgagccttctcgtgagatgaagagtcaatgg
acagcagtctgggtgaaaatctcttccagttggattggcattgtgctgtatgtttggaca
ctggtggcaccacttgttcttaccaatcgggattttgactga

DBGET integrated database retrieval system