KEGG   Rattus norvegicus (rat): 294429
Entry
294429            CDS       T01003                                 

Symbol
Ranbp2
Name
(RefSeq) E3 SUMO-protein ligase RanBP2
  KO
K12172  E3 SUMO-protein ligase RanBP2 [EC:2.3.2.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  Nucleocytoplasmic transport
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    294429 (Ranbp2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    294429 (Ranbp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    294429 (Ranbp2)
   03110 Chaperones and folding catalysts [BR:rno03110]
    294429 (Ranbp2)
   04121 Ubiquitin system [BR:rno04121]
    294429 (Ranbp2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     294429 (Ranbp2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     294429 (Ranbp2)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    294429 (Ranbp2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   294429 (Ranbp2)
SSDB
Motif
Pfam: Ran_BP1 zf-RanBP IR1-M Pro_isomerase WH1 TPR_1 TPR_2 TPR_14 TPR_8 TPR_16 TPR_11
Other DBs
NCBI-GeneID: 294429
NCBI-ProteinID: NP_001178533
RGD: 1560047
Ensembl: ENSRNOG00000000796 ENSRNOG00000056428
UniProt: M0R3M4
Position
20
AA seq 3088 aa
MRRSKAEVERYIASVQGSAPSPREKSMKGFYFAKLYYEAKEYDLAKKYISTYINVQERDP
KAHRFLGLLYEIEENTDKAVECYKRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVER
AAKLFPGSPAIYKLKEQLLDCKGEDGWNKLFDLIQSELYARPDDVHVNIRLVELYRSNKR
LKDAVAHCHEADRNMALRSSLEWNSCVVQTLKEYLESLQCLDSDKSTWRATNKDLLLAYS
NLMLLTLSTRDVQESRELLESFDSALQSVKSSVGGNDELSATFLETKGHFYMHVGSLLLK
MGQQSDIQWRALSELAALCYLIAFQVPRPKVKLIKGETGQNLLEMMAHDRLSQSGHMLLN
LSRGKQDFLKEVVESFANKSGQSALCDALFSSQSSKDRSFLGNDDIGNLDGQVPDLDDLA
RYDTGAVRAHSGSLQHLTWLGLQWNSLPTLPAIRKWLKQLFHHLPQETSRLETNAPESIC
ILDLEVFLLGVIYTSHLQLREKSNSHHTSYQPLCLPLPVCRQLCTERQKSWWDAVCTLIH
RKALPGTSAKLRLLVQREINSLRGQEKHGLQPALLVHWAQSLQKTGSSLNSFYDQREYIG
RSVHYWRKVLPLLKMIRKKNSIPEPIDPLFKHFHSVDIQVSEIGEYEEDAHITFAILDAV
NGNIEDAMTAFESIKNVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIK
ILDDSDSNISVVQKLPVPLESVKEMLNSVMQELEDYSEGGTLYKNGCFRSADSELKHSTP
SPTKYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSNNSASPHR
WPAEHYRQDPVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYSQQMHTPPVQSSSSCMFSQEMYGPPLRFESPATGILSPRGDDY
FNYNVQQTSTNPPLPEPGYFTKPPLVAHASRSGESKVIEFGKSNFVQPMQGEVIRPPLAT
PAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVTQSPSTAYSNSESLLGLLTSDKPLQGDGY
SGLKPISAQTGGSRNTFSFGSKSTLTENMGPNQQKNFGFRRSDDMFTFHGPGKSIFTTPT
SELANKSHETDGGSAHGDEEDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDG
ESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVW
HALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQNILKALGTNASTAANHTLRIVKEP
ATQDNKDICKSDGGNLNFEFQIVKKEGPFWNCNSCSFKNAATATKCVSCQNTKPTNGKEL
LGSPLVENGFASKTGPENVQDRFALMTPNKEGHWDCSVCLVRNEPTVSRCIACQNTKSAN
KNGSSFAQTSFKFGQGDLSKSADSDFRSVFSKKEGQWDCSICLVRNEASSTKCVACQNPA
KQAPVSSPASFKAGTSDVSKTSKSGFDDMFAKKEGQWDCSLCSVRNEANAVKCVACQNPV
KPSSSTTVTVLPSFKFGTSEMTKPPRSGFEGMFAKKEGQWDCSLCFVRNEASASQCIACQ
NPNKQNQPTSAVSAPASSETSKSPKCGFEGLFTRKEGEWECTVCSVQNESSSLKCVSCDA
SKPTHKPIAEAPSAFTVGSKSQLNESAGSQVGTEFKSNFPEKNFKVGISEQKFKFGHVDQ
EKTPSFTFQGSSNTEFKSIKDGFSFCIPVSADGFKFGIQEKGNQEKKSEKHLENDPGFQA
HDTSGQKNGSGVVFGQTSSTFTFADLAKSTSREGFQFGKKDPNFKGFSGAGEKLFSSQSG
KVAEKANTSDLEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRVKLFRF
DAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAW
MWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAK
LIQRAEEMKSGLKDFKTFLTNDQAKVTEEENTSSGADASSASDTTVKQNPDNTGPALEWD
NYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKSPAKLN
QSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLIEVSSGEENEQVVFSHRAKLYRYDKD
VGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQTMKGTERVWVWT
ACDFADGERKIEHLAVRFKLQDVADSFKKIFDEAKTAQEKDCLITPHVSHLSTPRESPCG
KIAIAVLEETTRERTDLTQGDEVVDTTSEAGETSSTSETTPKAVVSPPKFVFGSESVKSI
FSSEKSKPFAFGNSSATGSLFGFSFNAPLKNSNSEISSIVQSGSEGKVDPDKGELPPNSD
IKQSSDGKVKNLIAFSKETSSTFKTPEKAREKNKPEDPPSDTDILIVYELTPTPEQKALA
EKLLLPSTFFCYKNRPGYVSEEEEDDEDFEMAVKKLNGKLYVDDSEKPLEENLADNDKEC
VIVWEKKPTVEERAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELRKVQEAQKSQSEK
VTNTVGIEQTGETEATNPDGSKSEEPDSDTKHSSSSPVPGTMDKPVDLSTKKETDMEFPS
QGESKTVLFGFGSGTGLSFADLASSNSGDFAFGPKDKNFQWANTGAAVFGTQSTSKDGDD
EDGSDEDVVHNEDIHFEPIVSLPEVEVKSGEEDEEVLFKERAKLYRWDRDVSQWKERGIG
DIKILWHSVKNYYRILMRRDQVFKVCANHVITKAMELKPLNFSNNALVWTASDYADGEAK
IEQLAVRFKTKEITECFKKKIEECQQNIMKLQNGQVSLAAELSKETNPVVFFDVCVDGEP
LGRIIMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVVPDFICQGGDITKYNGTGGQ
SIYGDKFDDENFDLKHTGPGLLSMANCGQNTNSSQFFITLKKAEHLDFKHVVFGFVKDGM
DTVRKIESFGSPKGSVSRRICITECGQL
NT seq 9267 nt   +upstreamnt  +downstreamnt
atgaggcgcagcaaggccgaggtggagcggtacatcgcctcggtgcagggctccgccccg
tcgccccgagagaagtcaatgaaaggattttattttgcaaagctgtactatgaagctaaa
gaatatgatcttgccaaaaaatacatttctacgtatattaatgtgcaagagagggaccct
aaagcccacagatttttgggtcttctttatgaaattgaagaaaatacagacaaagctgta
gaatgttataagcgttcagtggaattaaacccaacgcaaaaagatcttgtgttgaagatt
gcagaattgctttgtaaaaacgatgtgaccgatggaagagcaaagtactgggttgagaga
gcggccaaactgtttccaggaagccctgccatctataagttaaaggaacaacttttagac
tgtaaaggtgaagatggatggaataaactttttgacttgattcaatcagaactttatgca
agacctgatgatgttcatgtaaatattcgactagtagagctttatcgttcaaataaaaga
ttgaaggatgccgtggcccactgccatgaggcagacaggaacatggctttacgttcaagt
ttagaatggaattcatgtgttgtccagactcttaaggaatatctggaatctctgcagtgt
ttggattctgataaaagtacttggagagcaaccaataaagacttacttctagcctattcc
aaccttatgctacttacactttccaccagagatgtgcaggaaagtagagagctattggag
agttttgatagtgctcttcagtctgtgaaatcttctgtgggtggaaatgacgagctatca
gctacgttcctagaaacgaaaggacatttctacatgcatgttggctctctgcttttgaag
atggggcagcagagtgacatccagtggcgagctctttctgagctggctgcattgtgctat
ctcattgcatttcaggttccaagaccaaaggttaaattaataaaaggagaaactggacaa
aatctactggaaatgatggcccacgatcgccttagccagtcagggcacatgttgttaaac
ttaagtcgtggcaagcaagactttctgaaggaagttgtggaatcttttgctaacaaaagt
ggccagtctgctctctgtgatgctctgttttctagtcagtcatccaaggatagatctttt
cttggtaacgatgatattggaaacctggatgggcaagtaccagacctagatgacttggct
agatatgatactggagctgttcgagcacatagtggtagtcttcagcaccttacctggctt
ggcttacagtggaactcactgcctactttaccagcaattcgaaaatggttaaaacagctc
ttccaccatttgcctcaggagacatcaaggcttgaaacaaatgcacctgaatcaatatgt
attttagatcttgaagtattcttactcggagtaatatataccagtcacttacaactaagg
gagaagagtaattctcaccacacttcctatcagccattgtgtttgccacttccagtgtgc
agacagctttgtacagaaagacagaagtcctggtgggatgcagtttgtactctgattcac
agaaaggcattacctggaacctcagcaaaattgcgacttctagttcaacgtgaaataaac
agtctgagaggccaggaaaagcacggcctacaacctgctctgcttgtgcattgggcacag
agtcttcagaaaacaggcagcagtcttaattctttttatgatcaacgggaatacataggc
agaagtgttcattattggaggaaagtcttaccattgttgaagatgatcagaaagaagaat
agtattcctgaacctattgatcctctgtttaaacatttccatagtgtggatattcaggta
tctgaaattggcgaatatgaagaagatgcacacataacttttgctatattggatgctgtt
aacggaaacatagaagatgccatgactgcttttgaatctattaaaaatgtagtttcttat
tggaatcttgcactgatttttcacaggaaagcagaagatattgaaaatgatgccttgtct
cctgaagaacaagaagagtgcaaaaattatctgagaaagactagggactacctgataaag
attttagatgatagtgattcaaatatttccgtggttcagaaattgcctgtcccccttgag
tctgtaaaagagatgctgaactcagttatgcaggaacttgaagactacagtgaaggaggt
actctttataaaaatggttgctttcgaagtgctgattcagagttaaagcattcaacacca
tctcctaccaaatattctctatcaccaagtaaaagttacaagtattcgccaaaaacacca
cctcgatgggcagaagatcaaaattctttattgaaaatgatctgccagcaagtagaggcc
attaagaaagaaatgcaggaattgaagctaaatagcaacaattctgcatcccctcatcgc
tggcctgcagaacattaccgacaagacccagttcctgatgggtatcaggggtcacaaact
tttcatggggctccactaacagttgcaactactggcccttcagtatattatagtcagtca
cctgcatataattcccagtatcttctcagaccagcagctaatgtaactcccacaaagggt
ccagtttatggcatgaataggcttccacctcaacaacatatttatgcatattcacaacag
atgcacacaccaccagtgcaaagttcatcttcttgtatgttctctcaggaaatgtatggt
cctcccttgcgttttgagtctcctgcaacaggaattctatcacccaggggtgatgattac
tttaattacaatgttcagcagacaagcacaaatccacctttgccagaaccagggtatttc
acaaagcctccacttgtagctcatgcttcaagatcgggagaatcaaaggttatagaattt
ggaaaatccaattttgttcagcccatgcagggtgaagtaataaggccacctttggcaaca
ccagcacatacaacacagccaactccctttaaatttaactcaaatttcaaatcaaatgac
ggtgacttcacattttcatcaccacaggtagtgacacagtctccttcaacagcttacagt
aacagtgaaagtcttttaggtctcctgacctcagataaacctttacaaggagatggctat
agtggactaaaaccaatatcagctcaaactggtgggtctcggaatacattcagttttgga
agcaaaagtacacttacagaaaacatgggcccaaatcagcagaaaaattttggttttcgt
cgaagtgatgatatgtttacttttcacggtccaggaaagtccatatttacaacacctact
tcagaactggcaaataaaagtcatgaaacagatggaggaagtgctcatggagatgaagag
gatgatggtcctcactttgagcctgtggtacctcttcctgacaagatagaagtaaaaacg
ggtgaggaagatgaagaagaattcttttgcaatcgtgcaaagttgttccgttttgatggt
gaatccaaagaatggaaggaacgtgggataggcaatgtaaaaatactaaggcacaaaaca
tctggtaaaattcgccttctgatgagacgagagcaagtattaaagatctgtgcaaatcat
tatataagccccgatatgaaactgacaccaaatgctggctcagatagatcttttgtatgg
catgcccttgattatgcagatgaattgcccaaaccagaacagcttgcaattagattcaaa
actcctgaggaagcagcactatttaagtgtaaatttgaagaggcccagaacattttaaaa
gccttaggaacaaatgcctctacagcagcaaatcatactcttagaattgtcaaagaacct
gcaactcaggataacaaggacatttgcaaatctgatggtggaaacttgaactttgaattc
cagattgtaaagaaggaagggcctttctggaattgtaacagctgctcgtttaagaatgct
gcaactgctacgaaatgtgtatcatgccaaaatacaaaaccaacgaatggcaaagagctc
ctaggttcaccattagttgaaaatggctttgcttctaaaactggcccagaaaatgttcaa
gatcgatttgcattgatgactccaaataaagaaggtcactgggattgcagtgtttgttta
gtaagaaacgaacccactgtatctaggtgcattgcatgtcagaacacaaagtctgctaac
aaaaatgggtcttcctttgctcaaacttctttcaaatttggccagggagatctttctaag
tctgctgacagtgacttcaggtctgtgttttctaaaaaagaaggtcagtgggattgcagt
atatgcctagtccgaaatgaagcaagctctacaaaatgtgttgcttgtcagaacccagca
aaacaggctcctgtctcatcacctgcttcttttaaggctggcacttcagatgtaagtaaa
acttcaaagagtggatttgatgacatgtttgctaagaaagaaggacagtgggattgtagt
ttgtgctcagtgagaaatgaagcaaatgctgtaaagtgtgttgcttgtcagaatccagtt
aaacccagttcatctaccactgttacagtacttccctctttcaagtttggtacctcagag
atgactaagcctcccaggagtggatttgagggcatgttcgccaagaaggaaggacaatgg
gattgcagcttgtgttttgtccgaaatgaagcaagtgcttctcaatgtattgcttgtcag
aatccaaataagcagaatcagcctacatctgctgtatcagctcctgcctcttcagagaca
agcaaatctccaaagtgtggttttgaaggcttgtttaccagaaaggaaggcgagtgggag
tgtactgtttgttctgtacaaaatgagagctcttccctaaaatgtgtgtcttgtgatgcc
tccaagccaactcataagcctattgcagaagctccttcagctttcacagtgggctcaaag
tcacagttaaatgaatctgcaggaagtcaagtgggaacagaattcaaaagtaactttcca
gaaaagaattttaaagttggcatatcagagcagaaatttaaatttgggcatgtggatcaa
gaaaaaacaccctccttcacctttcagggttcttctaatacagaatttaagtcaatcaag
gatggatttagtttttgcattcctgtatctgctgatgggtttaagtttggcattcaggag
aagggaaatcaagagaagaagagtgagaaacatcttgaaaatgatcctggtttccaagct
catgatactagtggtcagaagaatggtagtggtgtggtctttggtcagacaagcagcacc
ttcacctttgcagatcttgcaaagtcaacttcaagagaaggatttcagtttggcaagaaa
gaccctaatttcaagggattttcaggtgcaggagaaaaattattctcatcacaaagtggc
aaagtggctgagaaagcaaatacttctgatcttgagaaagatgacgatgcctataagacc
gaggacagcgatgacatccattttgaaccagtagtgcagatgccggaaaaagtggaactt
gtaacaggggaagaagatgaaaaagttttgtattctcaaagggtgaaattatttagattt
gatgctgagataagtcagtggaaagaaagaggtttggggaacttaaaaattctcaaaaat
gaagtcaatggtaaactaagaatgctgatgcgaagagaacaagtactaaaagtttgtgcc
aatcattggataaccactacgatgaacctgaagcctctctcagggtcagatagagcatgg
atgtggctagccagtgatttctcagatggcgatgctaaactggaacaattggctgcaaag
tttaaaacgccagaactagctgaagaattcaagcagaaatttgaggagtgtcaaagactt
ctcttagacattccacttcagacaccccataaacttgtagatactggcagggctgctaaa
ttaatacaaagagctgaggaaatgaagagcggactgaaagatttcaaaacatttttgaca
aatgatcaagcaaaagtgactgaggaagagaacacaagttcaggtgcagatgcttccagt
gcctcagacactacagtcaagcaaaaccctgataacactgggcccgccttagaatgggat
aactatgacttacgggaagacgccttggatgacagtgtcagcagcagctcagttcatgct
tctccattggcaagcagccctgtgcggaaaaacctcttccgctttggtgagtcaactaca
ggatttaacttcagttttaaatctgctctgagtccatctaagtctcctgccaagttgaac
cagagtggaacttcagttggcactgatgaagagtctgatgttactcaagaagaagagaga
gatggacagtactttgaacctgttgttcccttacctgatctaattgaagtatccagtggt
gaggaaaatgaacaagttgtttttagtcacagagcaaagctctacagatatgataaagat
gttggtcagtggaaagaaagaggcattggagatataaaaattttacagaattacgataat
aaacaggttcgcatagtgatgagaagggaccaggtattaaaactttgtgccaatcatagg
ataactccagatatgactttgcaaactatgaaagggactgaaagagtatgggtgtggact
gcatgtgattttgcagatggagaaagaaaaatagaacatttagctgttcgttttaaacta
caagatgttgcagactcatttaagaaaatttttgatgaagcaaaaacagcacaagaaaaa
gattgtttgataacacctcatgtttctcatctgagcacccctagagagtcaccatgtggc
aaaattgctattgctgtcttagaagaaaccacaagagaaaggacagatttaactcaagga
gatgaggtagtagatacaacttcagaggctggagaaacatctagcacttctgaaacaaca
ccaaaagcagtagtttctcctcctaagtttgtatttggctctgaatctgttaaaagcatt
tttagtagtgaaaaatcaaagccatttgcatttggcaacagttcagccactggttctttg
tttggatttagttttaatgcacctttgaaaaatagcaatagtgaaattagttcaatagtc
cagagtggatctgaagggaaagtagaccctgacaaaggcgagctgccaccgaactctgac
atcaagcaatcttctgatggcaaagtcaagaatctcattgccttttcaaaagagacctct
tcaacgtttaaaacaccagaaaaggcccgagagaagaataaacctgaagatcctccctca
gatactgatattctcattgtgtatgaactcactcccactcctgagcagaaagcccttgca
gagaaacttctgcttccttcaactttcttttgttataagaataggccaggttatgttagt
gaagaagaggaggatgatgaagattttgaaatggccgtcaagaaacttaatggaaaactc
tatgtggatgactcagaaaaaccattggaagaaaatctagcagataatgacaaagaatgt
gttattgtttgggagaagaagccaacagttgaagagagagcaaaagcagatactttaaag
cttccgcctacatttttctgtggagtctgcagtgacactgatgaggacaatggaaatggg
gaggattttcagtcagagcttcggaaagttcaggaagctcagaaatcccagagtgagaaa
gtgactaacacagttggtattgagcagacaggtgagactgaagcaacaaaccccgatggc
tctaagtctgaagaacccgattccgataccaaacacagtagctcatctcctgtccctggg
actatggacaagcctgtagatttgtccactaaaaaagaaactgacatggaattcccaagc
caaggggaaagcaagactgttttgtttggatttggaagtggtacaggcctgtcatttgca
gacttggcttcaagtaattctggagattttgcttttggtcctaaagataaaaatttccag
tgggcaaacactggagcagctgtgtttggaacacagtctacaagtaaagatggtgacgat
gaagatggcagtgatgaagacgtagttcacaatgaggacatccactttgaacccatagtc
tccttaccagaggtagaagtgaaatctggagaagaagatgaagaagttttgttcaaagag
agagccaaactttatagatgggatagagatgtcagtcagtggaaggagagaggtattgga
gatataaagattctttggcattcagtgaagaattattatcggatcctaatgagaagagac
caagtttttaaagtgtgtgcaaaccatgttattaccaaagccatggaattaaaaccttta
aatttttcaaacaatgctttagtttggactgcctcagattatgctgatggagaagcaaaa
atagaacagcttgcagtgagatttaagacaaaggaaataactgagtgttttaagaaaaaa
attgaagaatgtcaacaaaatataatgaaactccagaatggacaagtatcccttgcagcg
gaattatctaaggagaccaatcctgtggtgttttttgatgtttgtgtggatggtgaacct
ctaggacggataatcatggaattattttcaaatattgttcctcaaactgctgagaacttc
agagcattatgcactggagagaagggctttggttttaagaactccatttttcaccgagta
gttccagattttatttgccaaggaggagatattaccaaatacaatggaacaggaggacag
tccatttatggagataaatttgacgatgaaaactttgatctaaaacacactggtcctggc
ttactatccatggccaattgcggccagaataccaacagttctcagttttttataacactg
aagaaagcagaacatttggactttaagcatgtagtgtttgggtttgttaaggatggcatg
gatactgtgagaaagattgaatcatttggttctcctaaagggtctgttagtagaagaatt
tgtatcacagaatgtggacagctataa

DBGET integrated database retrieval system