KEGG   Rattus norvegicus (rat): 294430
Entry
294430            CDS       T01003                                 

Gene name
Fam26f, RGD1304835
Definition
(RefSeq) family with sequence similarity 26, member F
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Ca_hom_mod
Other DBs
NCBI-GeneID: 294430
NCBI-ProteinID: NP_001020147
RGD: 1304835
Ensembl: ENSRNOG00000037757
UniProt: Q561R8
Position
20q11
AA seq 315 aa
MEKFKAVLDLQIKHRSALGYGLVTLLTAGGEKIFSTVVFQCPCTATLNLTYGLVFLLVPA
LALFLLGYALSARTWRLLTGCCSRSASTRSSSGLRSTLVCAQVSAVAALAPLTWVAVALL
GGSFYQCAVSGSTRLASYLCKDRNHSCIAKLPQVPCNKQEAEMQEILSQLKAQSQVLGWV
LIAAVIFLLLVFKCVSRCFSPVSYLQLKFWEIYLEKEKQILQSQAAEHATQLARENIRSF
FECSKPKECNTPSRKDWQQISALYTFNSKNQFYSMLHKYVSRKEVSSSLHSVEGDVVVPV
LGFVDDAAMANTHGV
NT seq 948 nt   +upstreamnt  +downstreamnt
atggagaagttcaaggcggtgctggacctgcagatcaagcaccgcagtgccctgggctat
ggcctggtgaccctgctgacggctggtggggagaagatcttctccacagtggtgttccag
tgtccctgcactgccaccttgaacctgacctacggcctggtgttcctgctggtgcctgct
ttagcgcttttcctcctgggctatgcgctgagcgcgcgcacatggcgtctgctcaccggc
tgctgctcccggagtgcaagcacgcgatccagttcggggttgcgcagcacactcgtatgc
gcgcaggtcagcgcggtcgcagcgctcgctcccctcacctgggtggccgtggcgctactt
gggggctccttctatcaatgtgctgtcagcgggagcacacgcttggcgtcatatttgtgc
aaggaccgcaaccacagctgcattgccaagctacctcaggttccctgcaacaagcaggag
gcggagatgcaggagatcctgagtcagctcaaggcccagtctcaggtgctcggttgggtt
ctgatagctgccgtcatcttcttacttctggtttttaagtgtgtgtcccgatgcttctct
ccggttagttatctgcagttaaaattctgggaaatctacttggaaaaggagaagcagatc
cttcaaagtcaagctgcagaacacgcgacccagttggcaagagagaatattagaagtttc
tttgagtgctcaaagccgaaggaatgcaacaccccaagcagaaaagactggcagcaaatc
tcagcattgtatacattcaattccaagaaccagttctacagcatgctgcacaagtacgtt
agcagaaaagaggtgagcagcagtctccactctgtggaaggagatgttgtggtccctgtc
cttggctttgtagatgatgctgccatggccaacactcacggagtgtga

DBGET integrated database retrieval system