KEGG   Rattus norvegicus (rat): 29448
Entry
29448             CDS       T01003                                 

Gene name
Rab7a
Definition
(RefSeq) ras-related protein Rab-7a
  KO
K07897  Ras-related protein Rab-7A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04144  Endocytosis
rno04145  Phagosome
rno05132  Salmonella infection
rno05146  Amoebiasis
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29448 (Rab7a)
   04145 Phagosome
    29448 (Rab7a)
   04140 Autophagy - animal
    29448 (Rab7a)
   04137 Mitophagy - animal
    29448 (Rab7a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29448 (Rab7a)
   05152 Tuberculosis
    29448 (Rab7a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    29448 (Rab7a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29448 (Rab7a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29448 (Rab7a)
   04031 GTP-binding proteins [BR:rno04031]
    29448 (Rab7a)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    29448 (Rab7a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29448 (Rab7a)
  Exosomal proteins of other body fluids (saliva and urine)
   29448 (Rab7a)
  Exosomal proteins of colorectal cancer cells
   29448 (Rab7a)
  Exosomal proteins of bladder cancer cells
   29448 (Rab7a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    29448 (Rab7a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU cobW ATP_bind_1 PduV-EutP Septin AAA_22 NTPase_1 AAA_16 AAA_7 SRPRB AAA_24 AAA_5 G-alpha ATPase_2 NB-ARC NACHT TniB
Other DBs
NCBI-GeneID: 29448
NCBI-ProteinID: NP_076440
RGD: 61908
Ensembl: ENSRNOG00000012247
UniProt: P09527
Structure
PDB: 
1VG8 1VG1 1VG0 1VG9

Position
4
AA seq 207 aa
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNERAKASAESCSC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggtcatcatcctgggagactctggtgttgga
aagacatcgctcatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca
ataggagcagactttctgaccaaggaggtgatggtggatgacagacttgttaccatgcag
atctgggacacagctggtcaagaacggttccagtctcttggtgtggccttctacagaggt
gcagattgctgcgttctggtgtttgatgtgactgcccccaacacattcaaaacccttgac
agctggagagacgagtttctcatccaggccagcccccgggatcctgagaacttccctttt
gttgtgttgggaaacaagattgacctggaaaacagacaagtggccacaaagagggcacag
gcttggtgctacagcaaaaacaacattccttacttcgagaccagtgccaaggaggccatc
aatgtggaacaggccttccagacaattgctcggaatgcccttaaacaggaaacggaagtg
gagctgtacaatgaattccctgaacccatcaaactggacaagaacgagcgggccaaggcc
tccgcagagagctgcagctgttga

KEGG   Rattus norvegicus (rat): 501854
Entry
501854            CDS       T01003                                 

Gene name
Rab7b
Definition
(RefSeq) ras-related protein Rab-7b
  KO
K07898  Ras-related protein Rab-7B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04145  Phagosome
rno05132  Salmonella infection
rno05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    501854 (Rab7b)
   04140 Autophagy - animal
    501854 (Rab7b)
   04137 Mitophagy - animal
    501854 (Rab7b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    501854 (Rab7b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    501854 (Rab7b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    501854 (Rab7b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    501854 (Rab7b)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    501854 (Rab7b)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    501854 (Rab7b)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 ATP_bind_1 cobW AAA_22 VirE AAA_14 Septin
Other DBs
NCBI-GeneID: 501854
NCBI-ProteinID: NP_001102798
RGD: 1562617
Ensembl: ENSRNOG00000039754
UniProt: D4A7A8
Position
13
AA seq 199 aa
MNPRKKVDLKLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDPESFEALDIWRDDVLAKIVPMEQSYPMV
VLGNKIDLEDRKVPQEVAHEWCKEKDMPYFEVSAKNDINVVQAFEVLASRALLRYQGIAE
NHLADSIKLSPGQPRSKCC
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaatccccgaaagaaagtggacttgaaacttatcattgttggtgcacttggtgtggga
aagacctctctccttcatcaatatgtacacaagacattttttgaggaataccagaccaca
ctgggggccagcatcctctccaaaattatcatactggatgacacaactttgaagctgcag
atctgggacacaggtggtcaagagcggttccgctcaatggtatcaacattctacaaaggt
tccgatggctgtatcctggcatttgatgttactgatccagagtcctttgaagccctggat
atctggagggatgatgtcctggcaaagatcgtccctatggagcagtcatatcccatggtg
gtgctgggcaacaaaatcgatctggaagataggaaggtgccccaggaggtggcccatgaa
tggtgtaaagagaaggacatgccatactttgaagttagtgcgaagaatgacatcaatgtg
gtgcaggcctttgaggttctggccagccgggctctgttgaggtaccaaggcattgccgag
aatcaccttgcagactccatcaagctctctccgggccaaccaaggagcaaatgctgctga

DBGET integrated database retrieval system