KEGG   Rattus norvegicus (rat): 294503
Entry
294503            CDS       T01003                                 

Gene name
Nodal
Definition
(RefSeq) nodal homolog precursor
  KO
K04666  nodal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    294503 (Nodal)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    294503 (Nodal)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    294503 (Nodal)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    294503 (Nodal)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   294503 (Nodal)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 294503
NCBI-ProteinID: NP_001099864
RGD: 1305994
Ensembl: ENSRNOG00000000556
UniProt: D3ZGK9
Position
20
AA seq 354 aa
MSVHCLPVLLLQTCWTLLHPRVATAAALPLWTRGQPSSPSPLAYMLSLYRDPLPRADIIR
SLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLLSPMDSPTKGPLTIDIFHQAKP
DPEQDPADCLERVWMERITVTPSQVTFASDSTVLEVTKPLSKWLKDPRALEKQVSSQAGK
CWHQSHTQPVPVTSTSVLMLYSNRPQEQRQLGGATLLWEAESSWRAQEGQLSVERSGWGR
RQRRHHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNH
AYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagtgtccactgccttcccgttcttcttctccaaacctgctggaccctactccacccg
cgcgtcgcgaccgcggccgctttgcctctgtggacacgggggcagccctcgtcaccgtcc
cctctggcgtacatgttgagcctctaccgagaccctctgcctcgggcggacatcatccgc
agcctccaggcgcaagatgtggatgtgactgggcagaactggaccttcacgtttgacttc
tcctttttgagccaagaagaggatctggtatgggcggagctccggttgcagctgctcagc
cctatggacagccccaccaagggtccactcaccattgacattttccaccaggccaagccg
gatccagagcaggacccggctgactgcctggagcgtgtttggatggagaggatcaccgtc
actccttctcaggtcacgtttgcctcagacagcacagtcctagaggtgaccaagccactc
tccaagtggctaaaggaccccagggcactggagaagcaggtgtccagtcaagcaggaaag
tgttggcatcagtcccacacccagcctgtccctgtcaccagtaccagtgtgctcatgctt
tactccaaccggcctcaggagcagaggcagctggggggcgccactttgctctgggaagcg
gagagctcctggcgggcccaggagggacagctgtccgtagagaggagtggatggggcaga
aggcaacgccgccatcatttgccagacagaagccaactatgtaggagggtcaagttccag
gtggacttcaacctgattggctggggctcctggatcatctacccgaagcagtacaatgcc
tatcgctgtgagggcgagtgtcctaaccctgtgggggaggagtttcaccctaccaaccac
gcctatatccagagcctgctgaaacgttaccagccccaccgggttccttctacatgctgt
gctcccgtgaagaccaagccactgagcatgctttatgtggacaatggcagggtcctcctg
gaacaccacaaggacatgattgtggaggagtgtgggtgcctctga

DBGET integrated database retrieval system