KEGG   Rattus norvegicus (rat): 294515
Entry
294515            CDS       T01003                                 

Gene name
Foxo3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04062  Chemokine signaling pathway
rno04068  FoxO signaling pathway
rno04137  Mitophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04722  Neurotrophin signaling pathway
rno04917  Prolactin signaling pathway
rno05213  Endometrial cancer
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    294515 (Foxo3)
   04151 PI3K-Akt signaling pathway
    294515 (Foxo3)
   04152 AMPK signaling pathway
    294515 (Foxo3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    294515 (Foxo3)
  09143 Cell growth and death
   04218 Cellular senescence
    294515 (Foxo3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    294515 (Foxo3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    294515 (Foxo3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    294515 (Foxo3)
  09149 Aging
   04211 Longevity regulating pathway
    294515 (Foxo3)
   04213 Longevity regulating pathway - multiple species
    294515 (Foxo3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    294515 (Foxo3)
   05223 Non-small cell lung cancer
    294515 (Foxo3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    294515 (Foxo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    294515 (Foxo3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    294515 (Foxo3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 294515
NCBI-ProteinID: NP_001099865
RGD: 1309196
Ensembl: ENSRNOG00000000299
Vega: OTTRNOG00000001101
UniProt: D3ZBQ1
Position
20
AA seq 672 aa
MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
DDDEDDEDSGGRGSSAMVIGGGVSSALGSGLLLEDSARLLSPGGQDLGTGPASSAGALSG
GTQTQLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQAAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDGPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLAENLMDDLLDNIALPPSQASPPGGLMQRSSSFPYTAKSS
GLGSPTSSFNSTVFGPASLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNARRNVMLRNDPMMSFAAQPTQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSASANLPV
MGHDKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccagcctccccggtcccgctctctccgctcgaagtggagctggaccca
gagttcgagccacagagtcggccacgctcctgtacgtggcccctgcagaggccggagctg
caggcgagcccggccaagccctcgggggagacggcggcagactccatgatccccgaggag
gacgacgatgaagacgacgaggacagcggcggccgaggcagctcggccatggtgatcggt
ggcggcgtgagcagtgcgctgggctccgggctgctcctcgaagattcggccaggctgctg
tctcccggagggcaggacctcgggacggggccagcgtcctccgcaggcgcgctgagtggg
ggcacgcagacgcagctgcagcctcagcagccactgccaccgccgcagccgggggcggct
gggggctctgggcaaccgaggaaatgctcctcgcggcggaatgcctgggggaacctgtcc
tacgctgacctgatcacccgcgccatcgagagctccccggacaaacggctcactttgtcc
cagatctacgagtggatggtgcgctgtgtgccctacttcaaggataagggcgacagcaac
agctctgcgggctggaagaactccatccgccacaacctgtcactgcacagccgtttcatg
cgggttcagaacgaagggactggcaagagctcttggtggatcatcaaccccgatggggga
aagagtgggaaggctccccggcggcgggccgtctccatggacaacagcaacaagtacacc
aagagccgaggccgggcagccaagaagaaggcggccctgcaggctgccccagagtcggca
gacgacagcccttcccaactctccaagtggccgggcagccccacatcccgcagcagcgac
gagctggacgcctggaccgacttccgctcgcgcaccaattccaacgccagcaccgtgagc
ggccgcctgtcacccatcttggcgagcacggagctggatgacgtccaggacgatgacggg
cccctctcccccatgctctacagcagctctgccagcctgtcgccttccgtaagcaagccg
tgtaccgtggagctgccgcggctgactgacatggcgggcaccatgaatctgaacgatggg
ctggccgagaacctcatggatgacctgctagataacatcgcgctcccgccctcccaggcg
tcgcctcctggcgggcttatgcagcggagctccagcttcccgtacaccgccaagagctcc
ggcctgggctccccaaccagctcctttaacagtaccgtgttcggacctgcgtcactcaac
tccctgcgccagtcgcccatgcagaccatccaggagaacagaccagccaccttttcttcc
gtgtcgcactacggcaaccagacactccaagacctgctcacttcggactcgctcagccac
agcgatgtcatgatgacccagtcagaccccttgatgtctcaggctagcaccgctgtgtcc
gcccagaacgcccgccggaacgtgatgcttcgcaacgacccaatgatgtcctttgccgcc
cagcctacccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctcttggtggcagccgtgccttgtcaaattctgtcagcaacatgggcttgagtgac
tccagcagcctcggctcagccaaacaccagcagcagtctcccgtcagccagtctatgcaa
accctctcggactctctctcaggctcctcactgtattcagccagtgcaaaccttcccgtc
atgggtcacgacaagttccccagtgacttggacctggacatgttcaatgggagcttggag
tgtgacatggagtccatcatccgtagcgaactcatggatgccgatgggttggattttaac
tttgactccctcatctccacacagaacgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcaaagctgggtgccaggctga

KEGG   Rattus norvegicus (rat): 84482
Entry
84482             CDS       T01003                                 

Gene name
Foxo1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04910  Insulin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    84482 (Foxo1)
   04152 AMPK signaling pathway
    84482 (Foxo1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    84482 (Foxo1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    84482 (Foxo1)
   04922 Glucagon signaling pathway
    84482 (Foxo1)
   04919 Thyroid hormone signaling pathway
    84482 (Foxo1)
  09149 Aging
   04211 Longevity regulating pathway
    84482 (Foxo1)
   04213 Longevity regulating pathway - multiple species
    84482 (Foxo1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84482 (Foxo1)
   05202 Transcriptional misregulation in cancer
    84482 (Foxo1)
  09162 Cancer: specific types
   05215 Prostate cancer
    84482 (Foxo1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    84482 (Foxo1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    84482 (Foxo1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    84482 (Foxo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    84482 (Foxo1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    84482 (Foxo1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 84482
NCBI-ProteinID: NP_001178775
RGD: 620283
Ensembl: ENSRNOG00000013397
UniProt: G3V7R4
Position
2
AA seq 649 aa
MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGSTAANPDATASLAS
ASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHSAPPQPP
PTGPLSQPPPVPPAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQI
YEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKS
GKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDD
FDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEIS
NPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYAKYTY
GQSSMSPVPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQ
PNSRVLGQNVLMGPNSVMPAYGSQAPHNKMMNPSSHTHPGHAQQTSSVNGRALPHVVNTM
PHTSAMNRLTPVKTPLQVPLSHPMQMSALGNYSSVSSCNGYGRMGVLHQEKLPSDLDGMF
IERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggccgaagcgcctcaggtggtggagaccgacccggacttcgagccgctgcctcggcag
cgctcctgcacctggccgctgcccaggccggagtttaaccagtccaactcgaccacctcc
agcccggcgccgtcgggcagcacggccgccaaccccgacgccacggcgagcctggcctcg
gcgtccgctgtcagcaccgactttatgagcaacctgagcctgctagaagagagcgaggac
ttcgcgcgggcaccgggttgcgtggccgtggcggccgcagctgccgccagtaggggcctg
tgcggggacttccagggcccggaggcgggctgcgtgcactcggcgccgccgcagccccca
ccgaccgggccgctgtcgcagcccccaccggtgcctccagccgccgcggggccactcgct
gggcagccgcgcaagaccagttcgtcgcgccgcaacgcgtggggcaacctgtcgtacgcc
gacctcatcaccaaggccatcgagagctcggcggagaagaggctcaccctgtcgcagatc
tacgagtggatggtgaagagtgtgccctacttcaaggataagggcgacagcaacagctcg
gcgggctggaagaattcaattcgccacaatctgtccctacacagcaagtttattcgagta
cagaatgaaggaactgggaaaagttcttggtggatgctcaatccagagggaggcaagagt
gggaaatcaccccggagaagagctgcatccatggacaacaacagtaaatttgctaagagc
cgaggacgggctgctaagaaaaaagcatctctccagtccgggcaagagggtcctggagat
agccctgggtctcagttttctaaatggcctgcaagccctgggtcccacagcaatgatgac
tttgataactggagtacatttcgtcctcgaaccagctcaaacgctagcaccatcagtggg
agactttctcccatcatgacagagcaggatgacctgggggatggggatgtgcattccctg
gtgtatccaccctctgctgccaagatggcgtctacactgcccagtctgtctgaaatcagc
aatccagaaaacatggagaaccttctggataatctcaatcttctctcatccccaacatct
ttaactgtgtcaacccagtcctcgcctggcagcatgatgcagcagacaccttgctattca
tttgcaccgccaaacaccagtctaaattcccccagccccaactacgcaaagtacacgtac
ggccaatccagcatgagccctgtgccccagatgcctatgcagacacttcaggacagcaaa
tcaagttatggaggattgaaccagtataactgtgccccaggactcttgaaagagttgctg
acttctgactctcctccccacaatgatattatgtcaccagtcgatcctggagtggctcaa
cccaacagtcgggtcctgggccaaaatgtactgatgggccctaactcagtcatgccagcc
tatggcagccaggcacctcataacaaaatgatgaaccccagttcccacacccaccctgga
catgcacagcaaacttcttcagtcaatggccgtgccctgccccatgtggtgaacaccatg
cctcacacatctgccatgaaccgcttgaccccagtgaagacacctttacaagtgcctctg
tcccaccccatgcagatgagtgccctgggcaactactcctctgtgagcagctgcaatggc
tatggtaggatgggtgtcctccaccaggagaagctcccaagtgacttggatggcatgttt
attgagcgcttggactgtgacatggagtccatcattcggaacgacctcatggacggagat
accttggattttaactttgataatgtgttgcccaaccaaagcttcccgcacagtgtcaag
actacaacacacagctgggtgtcaggctag

DBGET integrated database retrieval system