KEGG   Rattus norvegicus (rat): 294518
Entry
294518            CDS       T01003                                 

Gene name
Sesn1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
rno04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    294518 (Sesn1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    294518 (Sesn1)
SSDB
Motif
Pfam: PA26
Other DBs
NCBI-GeneID: 294518
NCBI-ProteinID: NP_001099866
RGD: 1307517
Ensembl: ENSRNOG00000000302
UniProt: D3ZJU4
Position
20q13
AA seq 462 aa
MAEGENEVRWEGLCSRDPTTRETALESVRQIVLRKTEYLRSAKETLSRPSDGLSNGVSLD
GMNKLLAHLLMLSKRCPFKDVRERSGFILKSVEAAARHQCSYLVNLHVSDFLHVGGDPKW
LNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYH
SLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVEETPVPSAGSALVSDSF
FEVEALMEKMKQLQECREEEEASQEEMASRFEMEKRDSMFVFSSDDDEVTPARDVSRHFE
DTSYGYKDFSRHGMHVPTFRVQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTM
AMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKR
MYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRYMT
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccgaaggagagaatgaagtgaggtgggagggtctgtgcagtagagacccaactact
agagagacagcactggaaagcgttaggcagattgttctgagaaaaaccgagtaccttcgt
tctgccaaagagacactttctcgaccttcggacgggctttcaaatggtgtttctttggat
gggatgaataaacttcttgcccatctgcttatgctgtccaagagatgtccctttaaagac
gtgagagagagaagcgggttcattctgaagagcgtcgaggcggcagccaggcatcagtgt
tcctacctggtgaatctacacgtcagtgactttcttcatgttggtggggaccccaagtgg
ctcaatggtttagagaatgctcctcagaaactgcagaatttaggagaacttaacaaagtg
ttagcccacaggccttggctaatcaccaaagaacacatcgaggggctgctgaaggctgag
gagcacagctggtctcttgcggagctggtccacgctgtggttctgctcacacactaccac
tctcttgcctccttcacatttggctgtggaattagtccagagatccactgtgacggtggc
cacaccttcagacctccttctgtcagtaactactgcatctgcgacattacgaatggcaac
cacagtgtggaggagacgccagtcccctcagcaggaagtgccttggtgagtgactccttc
tttgaggtcgaagccctcatggaaaagatgaagcagttacaggagtgccgggaggaggag
gaggccagccaggaggagatggcctcgaggtttgaaatggagaagagagatagcatgttt
gtcttctcttcagatgatgatgaagttacaccagcgagagatgtgtctcggcactttgag
gacactagttatggctacaaggatttctccaggcatgggatgcatgttccaacatttcgt
gtccaggactactgctgggaggaccatggttattctctggtgaatcgtctttatccggat
gtgggacagttaatcgatgagaaatttcacattgcttacaaccttacttacaataccatg
gcaatgcacaaagatgttgatacctcaatgctgcgacgggctatctggaactatatccac
tgcatgttcggaatacgatacgatgactatgactacggggagattaaccagctgttggat
cgtagctttaaagtttatatcaaaactgtcgtgtgcactcctgaaaaggtcaccaaaaga
atgtatgatagcttctggaggcagttcaagcactctgagaaggttcatgttaatctgctt
cttatagaagcgaggatgcaagcggagctcctgtatgctctgagagccattacccggtat
atgacctga

DBGET integrated database retrieval system