KEGG   Rattus norvegicus (rat): 29455
Entry
29455             CDS       T01003                                 

Gene name
Gdf15
Definition
(RefSeq) growth differentiation factor 15
  KO
K05504  growth differentiation factor 15
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29455 (Gdf15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29455 (Gdf15)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   29455 (Gdf15)
SSDB
Motif
Pfam: TGF_beta BcsB
Other DBs
NCBI-GeneID: 29455
NCBI-ProteinID: NP_062089
RGD: 2674
Ensembl: ENSRNOG00000019661
UniProt: Q9Z0J6
Position
16p14
AA seq 303 aa
MALRALHAQPTGGPQLRFLLFLLLLLLLLSWPSQGDALALPEQRRSLSESQLNPDELRGR
FQDLLSRLHANQSREDSNSEPTPDPAVRILSPEVRLGSHGRLLLRVNRASLTQGLPEAYR
VHRALLLLTPSSRPWDITRPLQRAISLQGPHARALRLRLAPPPDLAVLPSGGARLELHLR
SAAGRGRRSAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECP
HLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGC
HCA
NT seq 912 nt   +upstreamnt  +downstreamnt
atggccctgcgcgcgctccatgcccagcctacaggcggtcctcagctgaggttcctgctg
ttcctgctgctcttgctgcttctgctgtcatggccatctcagggggacgccctggcattg
cctgagcagcgacgctccctctctgagtcccaactcaacccggacgagctacggggtcgc
ttccaggacctgctgagccgactgcatgccaaccagagccgggaggactcgaactcagaa
ccaacccctgacccagctgtccggatactcagtccagaggtgcgattggggtcccacggc
cggctgctgctccgcgtcaaccgggcgtcgctgactcagggtctccccgaagcctaccgc
gtgcaccgagcgctgctcctgctgacgccttcgtccaggccctgggacatcaccaggccc
ctgcaacgtgcgatcagcctccagggaccccacgctcgcgcactgcgcttgcgcctggcg
ccgcctcccgacctagccgtgctgccctctggcggcgcgcgcctggaactgcacttacga
tcggccgccggcagggggcgccgaagcgcgcatttgcacccaagagactcgtgcccgctg
ggtcccgggcgctgctgtcacctggagactgtgcaggcaactctcgaggacctaggttgg
agcgactgggtactgtccccgcgtcagctgcaactgagcatgtgcgtgggcgagtgcccc
cacctctaccggtcggccaacacgcatgcgctgatcaaagcacgcctgcatggcctgcag
cccgacagagtgccggccccgtgctgtgtcccctccagctacaccccggtggttcttatg
cacaggacagacagcggcgtgtcactgcagacttatgatgatctggtagcccagggctgc
cactgcgcttga

DBGET integrated database retrieval system