KEGG   Rattus norvegicus (rat): 294560
Entry
294560            CDS       T01003                                 

Gene name
Mcu
Definition
(RefSeq) calcium uniporter protein, mitochondrial precursor
  KO
K20858  calcium uniporter protein, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04218  Cellular senescence
rno04621  NOD-like receptor signaling pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    294560 (Mcu)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    294560 (Mcu)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    294560 (Mcu)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    294560 (Mcu)
   05012 Parkinson disease
    294560 (Mcu)
   05014 Amyotrophic lateral sclerosis
    294560 (Mcu)
   05017 Spinocerebellar ataxia
    294560 (Mcu)
   05020 Prion disease
    294560 (Mcu)
   05022 Pathways of neurodegeneration - multiple diseases
    294560 (Mcu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    294560 (Mcu)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    294560 (Mcu)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    294560 (Mcu)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   294560 (Mcu)
SSDB
Motif
Pfam: MCU SPX Optomotor-blind
Other DBs
NCBI-GeneID: 294560
NCBI-ProteinID: NP_001099868
RGD: 1589771
Ensembl: ENSRNOG00000045920
UniProt: M0RDI5
Position
20
AA seq 350 aa
MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRQRPHQQHRTAHQRPASWQSV
GAAYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRG
IDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAETLNDVKT
LVQQLYTTLCIEQHQLNKERELVERLEDLRQQLAPLEKVRIEISRKAEKRTTLVLWGGLA
YMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLL
FFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKE
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcggccgccgcaggtagatcgctcctgctgctgctctgctcccggggcggcggcggg
ggcgccggcggctgcggagcgctgactgccggctgctttcccgggctgggcgtcagccgc
cagcggccgcaccagcagcaccggacggcacaccagaggccggcgtcctggcagagcgtg
ggtgctgcatattgcagtacggttgtgccctctgatgacgtgacggtggtttatcaaaat
ggtttaccggtgatatctgtgaggctaccttctcggcgagaacgctgccagttcacactc
aagcctatctcggactccgtcggggtgtttctccgacaactgcaagaggaggatcgggga
atcgaccgcgttgccatctattccccagatggtgttcgagttgctgcctccacggggata
gacctcctgctcctcgatgactttaagcttgtcattaatgacttaacataccacgtacgg
ccaccaaagagagacctcctgagccatgaaaacgcagagaccctgaacgatgtgaagacg
ctggtccagcagctctacaccacactgtgcattgagcagcatcagcttaataaggagcgg
gagctcgtggagaggttagaggacctcagacagcagctggcccccctggagaaggtacgg
attgaaattagcaggaaagcggagaagaggaccactctggtgctatggggaggccttgcc
tacatggccacacagtttggcattttggcccggcttacctggtgggaatactcctgggac
atcatggaaccggtcacctacttcatcacgtatgggagcgccatggccatgtatgcgtat
tttgtaatgacgcgccaggaatatgtttatcctgaagccagagacagacaatacttatta
tttttccataaaggagccaaaaagtctcgtttcgacctagagaaatacaatcaactcaag
gatgcaattgctcaggcagaaatggatcttaagagactgagagacccgctacaagtacat
ctgcccctccgacagatcggagaaaaggaatga

DBGET integrated database retrieval system