KEGG   Rattus norvegicus (rat): 294562
Entry
294562            CDS       T01003                                 

Gene name
Pou5f1
Definition
(RefSeq) POU class 5 homeobox 1
  KO
K09367  POU domain transcription factor, class 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    294562 (Pou5f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    294562 (Pou5f1)
   03021 Transcription machinery [BR:rno03021]
    294562 (Pou5f1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    294562 (Pou5f1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     294562 (Pou5f1)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN Lsr2
Other DBs
NCBI-GeneID: 294562
NCBI-ProteinID: NP_001009178
RGD: 1359491
Ensembl: ENSRNOG00000046487
Vega: OTTRNOG00000001656
UniProt: Q6MG27
Position
20p12
AA seq 352 aa
MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPSGPGIGPGSEVLGISPCPP
AYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGASSGPCTARPSAVKLE
KVEPSPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRF
EALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWNLEN
MFLQCPKPSLQQITSIAKQLGLERDVVRVWFCNRRQKGKRSSIEYSQREEYEAAGKPFPG
GAVSFPLPPGPHFGAPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggctggacacctggcttcagacttcgccttctcacccccacctggtgggggtgatggg
tcagcagggctggagccgggctgggtggaccctcgaacctggctaagcttccaggggcct
ccaagtgggcctggaatcggaccaggttcagaggtgctggggatctccccgtgtccccca
gcatacgagttctgtggagggatggcatactgtggacctcaggttggactgggcctagtc
ccccaagttggcgtggagactctgcagcccgagggccaggcaggagcacgagtggagagc
aactcggagggagcctcctctgggccctgtactgcccgccccagcgccgtgaagttggag
aaggtggaacctagtcccgaggagtcccaggatatgaaagccctgcagaaggagctagag
cagtttgccaagctgctgaaacagaagaggatcaccttggggtacacccaggccgacgtg
gggctcaccctgggcgttctctttggaaaggtgttcagccagacaaccatctgccgcttc
gaggccctgcagctcagccttaagaacatgtgtaagctgcggcccctgctggagaagtgg
gtggaggaagctgacaacaacgagaaccttcaggagatatgcaaatcggagaccctggtg
caggcccggaagagaaagcggactagcattgagaaccgtgtgaggtggaacctggagaac
atgtttctgcagtgcccgaagccctccctgcagcagatcactagcattgccaagcagctt
gggctggagagggatgtggttcgagtgtggttctgtaaccggcgccagaaggggaaaaga
tcgagcattgaatattcccaacgagaagagtatgaggccgcggggaaacctttcccaggg
ggggctgtgtcctttcctctgcccccaggcccccactttggtgctccaggctatgggagc
ccccatttcaccacactctactcggtcccttttcctgagggcgaggcctttccctctgtt
cctgtcactgctctgggctctcccatgcattcaaactga

DBGET integrated database retrieval system