KEGG   Rattus norvegicus (rat): 29457
Entry
29457             CDS       T01003                                 

Gene name
Map6, Mtap6
Definition
(RefSeq) microtubule-associated protein 6
  KO
K10432  microtubule-associated protein 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29457 (Map6)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     29457 (Map6)
SSDB
Other DBs
NCBI-GeneID: 29457
NCBI-ProteinID: NP_058900
RGD: 61804
Ensembl: ENSRNOG00000027204
UniProt: Q63560
Position
1q32
AA seq 952 aa
MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPAPPQPGLAPPSRA
VAIETQPAQGESDAVARATGPAPGPSGDRETAAAPGRSGLGLGAASGSTSGSGPADSVMR
QDYRAWKVQRPEPSCRPRSEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQIPA
TSQPSPPVLGMPKRRPQSQERGPIQLSADARDPEGAGGAGVPAAGKASGADQRDTRRKAG
PAWMVTRTEGHEEKPLPPAQSQTQEGGPAAGKASGADQRDTRRKAGPAWMVTRTEGHEEK
PLPPAQSQTQEGGPAAGKASGADQRDTRRKAGPAWMVTRTEGHEETPLPPAQSQTQEGGP
AAGKASGADQRDTRRKAGPAWMVTRTEGHEETPLPPAQSQTQEGGPAAGKASGADERDTR
RKAGPAWMVRRSEGHEQTTAAHAQGTGPEGGKGRAVADALNRQIREEVTSTVSSSYRNEF
RAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTADNKVVDRRRIRSLYS
EPFKESPKVEKPSVQSSKPKKTSTSQKPLRKAKDKQVASGQAAKKKTTESPSATKPDDKE
QSKEMNNKLAEAKESRVKPTSDKNQGPVAKEPHKDQGPVAPGLPKGQGPAVQEPLKDQGP
MVPGLPKDQAPVVPGSLKGQSPTAPGPPKDQGAVLLGPMKDLGPVAPASVKDQDHMASEL
LKNKDSVPLAPAKAQSPLLPEPLKNQSPVVPARAKDQSFPAPAPTPLKDPGPVIPEPEKD
GAPMVPERRKDQNASIMASLKNEAPVASESVKNQGLGGPEPAKDTGTDLKGHGSVFVAPV
KSQGPVVPEPTKGQDPIIPALAKDQGPILPEPPKNQGPPVVLGPIKNQDPVIPVPLKGQD
PVVPAPTKDPGPTAPDPLKSQGPRGPQLPTVSPSPPVMIPTVPHAEYIEGSP
NT seq 2859 nt   +upstreamnt  +downstreamnt
atggcgtggccgtgcatcactagggcctgctgcatcgcccgcttctggaaccagctggac
aaggcggacattgcggtgccgctggttttcaccaagtactcggaggccaccgaacatcca
ggcgcccctccgcagccaccagcgccgccgcagcccgggttagcgcccccctcgcgtgct
gtcgccatagagacgcagccagcccagggagagtcggatgcagttgcccgggcaacaggg
ccggcacccgggcccagcggtgaccgcgagactgcagccgcccccggccggagcgggctg
ggcttgggcgcggcctccggctccacttccggctcaggcccggcggactcggtgatgcga
caggactaccgtgcctggaaggtgcagcggcccgagcccagctgccggccgcgaagcgag
taccagccgtccgacgcgcccttcgagcgcgagacccagtaccagaaggacttccgcgcc
tggccactgccccgccgcggggaccacccctggatccccaagcccgtgcagatccctgcg
acttcgcagccttccccgcctgttctcgggatgcccaagcgtcggcctcaaagccaagag
cgcgggcccatacaactttctgctgatgcccgggacccggagggtgctggaggagccggg
gtgccggcggccggaaaggcgtccggtgcagaccagcgtgacacacgccggaaggcaggg
ccagcatggatggtgactcgcaccgaagggcacgaggagaagcctctgcccccggcccag
tcccagacccaggaaggcggtcctgcagctggaaaggcgtccggtgcagatcagcgtgac
acacgccggaaggcgggacccgcgtggatggtgactcgcaccgaagggcacgaggagaag
cctctgcccccggcccagtcccagacccaggaaggcggtcctgcagctggaaaggcgtcc
ggtgcagatcagcgtgacacacgccggaaggcgggacccgcgtggatggtgactcgcacc
gaagggcacgaagagacgcctctgccacccgcccagtcccagacccaggagggcggccct
gccgctggaaaggcgtccggtgcagatcagcgtgacacacgccggaaggcgggacccgcg
tggatggtgactcgcaccgaagggcacgaagagacgccgctgccacccgcccagtcccag
acccaggagggcggccctgccgctggaaaggcatctggtgcagatgaacgcgacacgagg
aggaaggcggggccggcctggatggtgcgtcgctccgaggggcacgagcagacgaccgct
gcccatgcccaaggcacagggcccgaaggaggcaaagggcgcgcggtggctgatgccctc
aacaggcaaattcgggaggaggtgacgagtacagtaagcagctcctacaggaacgaattc
agagcgtggacagacatcaagcctgtgaaaccaatcaaagccaagccccagtacaagccc
ccagatgacaagatggttcacgaaaccagctacagtgcccagttcaaaggggaggccagt
aagcccaccacagcggacaacaaggtcgtggatcgcagaagaatacgaagcctctacagt
gagcctttcaaggaatccccgaaggtggagaaacctagtgttcagagttccaaaccaaaa
aagacctcaacgagccagaagcccctgaggaaggccaaagacaagcaggtggcgtcgggc
caggccgccaagaaaaagaccacagagagccccagtgccaccaaacctgacgacaaggag
caaagcaaagagatgaacaataaactggctgaggcgaaagagagccgggtcaaacccacc
agtgataagaatcaaggtcctgtagccaaagagccacacaaggatcaaggtcctgtggcc
ccaggtcttccgaaaggccaaggtcctgcggtccaagagcctttgaaggatcaaggcccc
atggtgccaggactgccaaaggaccaagcccctgtagtcccagggtccttaaagggtcaa
agccctacagccccaggcccgccaaaggatcaaggtgctgtgctcttagggcccatgaag
gatctaggtccagtggccccagcatccgtcaaggatcaagaccatatggcgtctgagctt
ctaaagaataaagattctgtccccttagcaccagccaaagcccaaagccctctgttgcca
gagcctctgaagaatcagagtcctgtggttccagcaagagctaaggatcaaagcttccca
gcaccagcaccaacacctctgaaggacccaggtcctgtgatccctgagcctgagaaagat
ggagctcccatggtcccagagcgtaggaaggaccagaatgcctccatcatggcatctctg
aagaacgaagctcctgtggcctctgagtctgtgaagaatcaaggcttaggaggcccagag
ccagccaaagacacaggtacggatctgaaaggacatggttctgtgtttgtagcacctgtg
aagagccaaggtccagtggttcctgagccaactaagggccaagaccccattatcccagca
ctagccaaggaccaaggtcccatactcccagagcctccaaagaatcaaggaccccctgtg
gtccttgggcctataaagaatcaagaccctgtaattccagtacctctgaagggtcaggat
cccgtggtgccagccccaaccaaggacccaggtcctacagcccctgaccctctgaagtct
caaggtcccagaggccctcaactgcccacggtctcaccttcacccccagtcatgatccca
acagtcccccatgcggaatatattgagggatccccttga

DBGET integrated database retrieval system