KEGG   Rattus norvegicus (rat): 29459Help
Entry
29459             CDS       T01003                                 

Gene name
Rbbp9
Definition
(RefSeq) RB binding protein 9, serine hydrolase
  KO
K07002  uncharacterized protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    29459 (Rbbp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ser_hydrolase Abhydrolase_1 Abhydrolase_6 DUF1057 Hydrolase_4 DUF3530 Abhydrolase_5
Motif
Other DBs
NCBI-GeneID: 29459
NCBI-ProteinID: NP_062092
RGD: 3542
Ensembl: ENSRNOG00000007972
UniProt: O88350
Position
3q41
AA seq 186 aa AA seqDB search
MASPTKAVIVPGNGGGDVATHGWYGWVRKGLEQIPGFQCLAKNMPDPITARESIWLPFME
TELHCDEKTIIIGHSSGAIAAMRYAETHQVYALILVSAYTSDLGDENERASGYFSRPWQW
EKIKANCPHIIQFGSTDDPFLPWKEQQEVADRLDAKLYKFTDRGHFQNTEFHELIRVVKS
MLTPAL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccctaccaaggcagtgattgttcctgggaacggaggcggggatgtggccacc
cacggctggtacggctgggtgagaaaggggctggagcagattcctggtttccagtgtttg
gctaaaaacatgcctgacccaattaccgctcgagagagcatctggctgcccttcatggag
acagaactgcactgtgatgagaagaccatcatcataggccacagttccggggccatcgca
gccatgaggtatgcagagacacatcaggtatacgctctcatattggtgtctgcatacaca
tcagacttgggagatgaaaatgagcgtgcaagtgggtacttcagccgcccctggcagtgg
gagaagatcaaggccaactgccctcacattatacagtttggctctactgatgaccccttc
cttccatggaaggaacaacaagaagtggcagataggctggacgccaaactgtacaaattc
actgaccgtggtcactttcagaacacagagttccatgaactgattagagtggtgaagtct
atgctgactcctgctctgtaa

DBGET integrated database retrieval system