KEGG   Rattus norvegicus (rat): 29460
Entry
29460             CDS       T01003                                 

Gene name
Tesk1
Definition
(RefSeq) dual specificity testis-specific protein kinase 1
  KO
K08841  testis-specific kinase 1 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29460 (Tesk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     29460 (Tesk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   29460 (Tesk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH Kdo
Other DBs
NCBI-GeneID: 29460
NCBI-ProteinID: NP_113766
RGD: 62059
Ensembl: ENSRNOG00000053729
UniProt: Q63572
Position
5
AA seq 628 aa
MAGERPPLRGPGPGETPVEGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFDCAEKIGA
GFFSEVYKVRHRQSGQVMVLKMNKLPSNRSNTLREVQLMNRLRHPNILRFMGVCVHQGQL
HALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIAQGLRYLHAKGVFHRDLTSKNCLVRR
EDGGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGI
VLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSARAPFT
EITQHLEQILEQLPEPTPLAKMPLAKAPLTYNQGSVPRGGPSATLPRSDPRLSRSRSDLF
LPPSPESPPSWGDNLTRVNPFSLREDLRGGKIKLLDTPCKPATPLPLVPPSPLTSTQLPL
VASPESLVQPETPVRRCRSLPSSPELPRRMETALPGPGPSPVGPSTEERMDCEGSSPEPE
PPGPAPQLPLAVATDNFISTCSSASQPWSARPGPSLNNNPPAVVVNSPQGWAREPWNRAQ
HSLPRAAALERTEPSPPPSAPREQEEGLPCPGCCLSPFSFGFLSMCPRPTPAVARYRNLN
CEAGSLLCHRGHHAKPPTPSLQLPGARS
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggccggggaacggccaccgctgcggggccccgggcccggagagactccggtggagggg
ccggggggcgcaggcggaggcccgggccggggccggccctcctcctaccgggccctccgc
agcgccgtgtccagcctggcgcgcgtggacgatttcgactgcgcagagaagatcggggct
ggtttcttctctgaggtctataaggttcggcaccgacagtcgggacaagtcatggtgctg
aagatgaacaagctccccagtaaccggagcaacactctaagggaggtgcagctgatgaac
cggctccggcatcctaacatcctcaggttcatgggggtctgtgtgcaccaagggcagctg
cacgcgcttacagagtatatgaatgggggtaccctggaacagctgctgagctccccagaa
cccctctcctggccagtcaggctccacctagcactggacattgcacaaggcctacggtac
ctacacgccaaaggtgtgtttcaccgagacctcacatccaagaactgtctggtccgacgg
gaagacggaggcttcacagctgttgtgggtgacttcggactggctgaaaagatccctgtg
tatagggaaggggcaaggaaggagccattggctgtggtgggctccccatactggatggcc
ccagaggtattgcggggagagctgtatgatgagaaggccgacgtcttcgcctttgggatt
gtcctctgtgagctcatcgcccgagtacctgcagaccctgactacctaccccgtactgag
gactttggtctggatgtgcctgcttttcgaactctggtgggaaatgactgtccgctacct
ttcctgcttctggccatccactgctgcagcatggaacccagcgcccgtgccccttttact
gaaattacccagcacctggaacaaatcctggagcagctgcctgagcccacgcccctcgcc
aagatgccccttgccaaggctcccttgacatacaatcaggggtctgttccaagaggaggt
ccctctgccacgcttcccaggtcagacccccggctctcccgaagccggtcagacctcttc
ctgccaccttcaccagaatcaccccccagttggggggacaatctaacacgagtcaacccc
ttctcactgcgggaagacctcaggggtggcaagatcaaacttctggacacaccctgcaag
ccggccactccactgcccctggtgccaccatcaccactgacctctacccagctgcccttg
gtggcctctccagagtccctggtccagcctgagactcccgtccgccgctgtcgttcactc
ccttcatcccctgagctcccccgacggatggaaactgcactgccaggtcctggcccgtcc
cccgtgggcccctcgactgaggaaaggatggactgtgagggcagcagccctgagccagag
cccccagggccggctccccagctgcctctggctgtggccactgacaacttcatcagtacg
tgttcctcagcctctcagccctggtctgctagaccaggaccttccctcaataataacccc
cctgctgtggtggtgaattccccacaaggatgggcgagggagccctggaaccgggcacag
catagccttccccgggcagcagccctggagcggacagaaccctcaccacccccatcagct
ccccgggagcaggaggaggggcttccctgccctggctgctgcctcagccccttcagcttt
ggcttcctatccatgtgcccccgccctaccccagctgttgcccgctaccgcaacttgaac
tgtgaggcgggcagtcttctctgccaccgagggcatcatgccaagccacccacacccagc
ctgcagctgcctggggcacgctcttag

DBGET integrated database retrieval system