KEGG   Rattus norvegicus (rat): 29462
Entry
29462             CDS       T01003                                 

Gene name
Avpr1b
Definition
(RefSeq) arginine vasopressin receptor 1B
  KO
K04227  arginine vasopressin receptor 1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29462 (Avpr1b)
   04072 Phospholipase D signaling pathway
    29462 (Avpr1b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29462 (Avpr1b)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    29462 (Avpr1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29462 (Avpr1b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Vasopressin
    29462 (Avpr1b)
SSDB
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 Srg
Other DBs
NCBI-GeneID: 29462
NCBI-ProteinID: NP_058901
RGD: 61886
Ensembl: ENSRNOG00000048522
UniProt: G3V6U8
Position
13q13
AA seq 421 aa
MNSEPSWTATPSPGGTLPVPNATTPWLGRDEELAKVEIGILATVLVLATGGNLAVLLTLG
RHGHKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLRQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQG
SGVLDCWADFYFSWGPRAYITWTTMAIFVLPVAVLTACYGLICHEIYKNLKVKTQAGREE
RRGWRTWDKSSSSAATRGLPSRVSSISTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMW
SVWDENAPNEDSTNVAFTISMLLGNLSSCCNPWIYMGFNSRLLPRSLSHHACCTGSKPQV
HRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSI
F
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaattctgagccttcttggactgccaccccctcccctgggggcaccctgcctgtcccc
aatgctaccacaccgtggctaggtagggatgaagagctagccaaggtggagatcggtatc
ctagctactgtcctggttctggccacaggaggcaacctggctgtacttctgactctgggc
cgccatggccacaagcgctcccgcatgcatctgttcgtgctgcacttggccctgaccgac
ctgggcgtggcgcttttccaggtactgcctcagctgctctgggacatcacctaccgcttc
cagggctctgacctcctctgccgggctgtcaagtatctacaggtgctcagcatgtttgct
tccacttacatgctgctggccatgacactggaccggtacctggctgtctgtcaccctctt
cgaagcctccggcagcccagccagtctacctaccctctcattgctgctccctggttgctg
gctgccatcctcagcctccctcaagttttcattttttcattgcgagaggtgatccagggc
tcaggggtgctggactgctgggcagatttctacttttcctggggcccgcgggcctacatc
acctggaccaccatggctatctttgtgctgccggtggcggtgctcacagcttgctacggc
ctcatctgccacgagatctacaagaacctgaaagtcaagacccaggctggcagggaggag
aggaggggctggcggacttgggataagtcctcatcttctgcagccacgagggggctacct
tcccgggtcagcagcatcagtaccatctccagggcaaagatccgaaccgtgaagatgacc
tttgtcatcgtgctggcctacattgcttgctgggcacctttcttcagtgtccagatgtgg
tctgtgtgggatgagaatgcccccaatgaagattctaccaatgtggctttcaccatctcc
atgcttctgggcaacctcagcagctgctgcaacccctggatctacatgggcttcaacagt
cgcctgttgccacgttccttgagccaccatgcctgctgcacgggctctaagccccaagtg
cacaggcaactctccaccagcagcctcactagccgtcgcactacgctgctgacccatgcc
tgtggttcccctactctccgactcagccttaacctcagcctccgtgcaaagcccagacct
gcaggctcactgaaggatttagagcaggtggacggggaagccactatggagaccagcatc
ttttag

DBGET integrated database retrieval system