KEGG   Rattus norvegicus (rat): 29464Help
Entry
29464             CDS       T01003                                 

Gene name
Slc6a6
Definition
(RefSeq) solute carrier family 6 member 6
  KO
K05039  solute carrier family 6 (neurotransmitter transporter, taurine) member 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29464 (Slc6a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   29464 (Slc6a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 29464
NCBI-ProteinID: NP_058902
RGD: 61912
Ensembl: ENSRNOG00000009019
UniProt: P31643
Position
4q34
AA seq 621 aa AA seqDB search
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEADGKPPQREKWSSKIDFVLSVAGGFVG
LGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEVIIGQYTSEGGITCWEKICPLF
SGIGYASIVIVSLLNVYYIVILAWATYYLFQSFQKDLPWAHCNHSWNTPQCMEDTLRRNE
SHWVSLSAANFTSPVIEFWERNVLSLSSGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVR
STGKVVYFTATFPFAMLLVLLVRGLTLPGAGEGIKFYLYPNISRLEDPQVWIDAGTQIFF
SYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIA
DVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS
FLRKGYRREIFIAIVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIA
WIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPALCVGCFIFSLVKYVPLTYNKVYRYPD
WAIGLGWGLALSSMVCIPLVIVILLCRTEGPLRVRIKYLITPREPNRWAVEREGATPFHS
RATLMNGALMKPSHVIVETMM
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaggagaagcttcaatgtctgaaagacttccacaaagacatcctgaagcct
tctccagggaagagcccaggcacgcggcctgaggatgaggctgatgggaagccccctcag
agggagaagtggtccagcaagatcgactttgtgctgtctgtggccggaggcttcgtgggt
ttgggcaatgtctggcgtttcccgtacctctgctacaaaaatggtggaggtgcattcctc
ataccgtattttattttcctgtttgggagcggcctgcctgtgtttttcctggaggtcatc
ataggccagtacacctcagaagggggcatcacctgctgggagaagatctgccccttgttc
tctggcattggctacgcgtccatcgtcatcgtgtccctcctgaatgtgtactacatcgtc
atcctggcctgggccacatactacctattccagtctttccagaaggatcttccctgggcc
cactgcaaccatagctggaacacgccacagtgcatggaggacaccctgcgtaggaacgag
agtcactgggtctcccttagcgccgccaacttcacttcgcctgtgatcgagttctgggag
cgcaacgtgctcagcctgtcctccggaatcgaccacccaggcagtctgaaatgggacctc
gcgctctgcctcctcttagtctggctcgtctgttttttctgcatctggaagggtgttcgg
tccacaggcaaggttgtctacttcactgctactttcccgtttgccatgcttctggtgctg
ctggtccgtggactgaccctgccaggtgctggtgaaggcatcaaattctacctgtaccct
aacatcagccgccttgaggacccacaggtgtggatcgacgctggaactcagatattcttt
tcctacgctatctgcctgggggccatgacctcactgggaagctataacaagtacaagtat
aactcgtacagggactgtatgctgctgggatgcctgaacagtggtaccagttttgtgtct
ggcttcgcaattttttccatcctgggcttcatggcacaagagcaaggggtggacattgct
gatgtggctgagtcaggtcctggcttggccttcattgcctacccaaaagctgtgaccatg
atgccgctgcccaccttttggtccattctgttttttattatgctcctcttgcttggactg
gacagccagtttgttgaagtcgaaggacagatcacatccttggttgatctttacccgtcc
ttcctaaggaagggttatcgtcgggaaatcttcattgccatcgtgtgcagcatcagctac
ctgctggggctgacgatggtgacggagggtggcatgtatgtgtttcaactctttgactac
tatgcagctagtggtgtatgccttttgtgggtcgcattctttgaatgttttgttattgcc
tggatatatggcggtgataacttatatgacggtattgaggacatgatcggctatcggcct
ggaccctggatgaagtacagctgggctgtcatcactccagctctctgtgttggatgtttc
atcttctctctcgtcaagtatgtacccctgacctacaacaaagtctaccggtaccctgat
tgggcaatcgggctgggctggggcctggccctttcctccatggtgtgtatccccttggtc
attgtcatcctcctctgccggacggagggaccgctccgcgtgagaatcaaatacctgata
acccccagggagcccaaccgctgggctgtggagcgtgaaggggctacgccctttcactcc
agagcaaccctcatgaacggtgcactcatgaaacccagtcacgtcattgtggagaccatg
atgtga

DBGET integrated database retrieval system