KEGG   Rattus norvegicus (rat): 29466Help
Entry
29466             CDS       T01003                                 

Gene name
Aes, Grg, Grg-5
Definition
(RefSeq) amino-terminal enhancer of split
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TLE_N HALZ FliG_N
Motif
Other DBs
NCBI-GeneID: 29466
NCBI-ProteinID: NP_062093
RGD: 2731
Ensembl: ENSRNOG00000052025
UniProt: P63003
Position
7q11
AA seq 197 aa AA seqDB search
MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRH
YVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELN
SIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQTHLSKEDK
NGHDGDTHQEDDGEKSD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttccgcaaagccggcactcgggctcctcccacctcccccagcagctcaagttc
accacctccgactcctgcgaccgcatcaaggatgagttccagctgctacaagcgcagtac
cacagcctgaagctggagtgtgacaagctggccagcgagaagtcagagatgcaaaggcat
tacgtcatgtactatgagatgtcttacggattgaacatcgagatgcacaaacaggctgaa
attgtgaagaggctgaatgggatttgcgcccaggttctaccctatttgtcccaggagcat
cagcagcaggtcctgggagctatcgagagagccaagcaggtcacggctcccgagctgaac
tccatcatccgacagcagctccaggctcaccagctgtcccagctccaggcgctggccctg
cccctgacaccgctgcctgtcgggctccagccgccatccctccctgcggtcagcgcaggc
acaggcctgctgtcactctctgctctgggctctcagacccacctctccaaggaggacaag
aacggacacgatggggacacccaccaggaggatgatggagagaagtccgattag

DBGET integrated database retrieval system