KEGG   Rattus norvegicus (rat): 294673
Entry
294673            CDS       T01003                                 

Gene name
Hexb
Definition
(RefSeq) hexosaminidase subunit beta
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00513  Various types of N-glycan biosynthesis
rno00520  Amino sugar and nucleotide sugar metabolism
rno00531  Glycosaminoglycan degradation
rno00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    294673 (Hexb)
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    294673 (Hexb)
   00531 Glycosaminoglycan degradation
    294673 (Hexb)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    294673 (Hexb)
   00604 Glycosphingolipid biosynthesis - ganglio series
    294673 (Hexb)
   00511 Other glycan degradation
    294673 (Hexb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    294673 (Hexb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    294673 (Hexb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     294673 (Hexb)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Others
   294673 (Hexb)
SSDB
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 294673
NCBI-ProteinID: NP_001011946
RGD: 1307607
Ensembl: ENSRNOG00000025274
UniProt: Q6AXR4
Position
2q12
AA seq 537 aa
MPGSPRRAPGLLLQALVAMVSLALVAPFGLQPALWPMPRSVQVFPRLLYISPENFQIDNS
PNSTAGPSCSLLLEAFRRYYNYIFGFYKRHHGPAKFQDKPQLEKLLVFINLEPQCDAFPS
MSSDESYSLLVQEPVALLKANEVWGALRGLETFSQLVYQDAYGTFTINESTIADSPRFPH
RGILIDTSRHYLPVKTIFKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSL
SHVYTPNDIHMVLEYARLRGIRVIPEFDSPGHTQSWGKGQKNLLTPCFIQKIRTQKVGPV
DPSLNTTYVFFDTFFKEISRVFPDQFIHLGGDEVEFECWASNPNIQNFMKKKGFGNNFRR
LESFYIKKILDIITSLKKSSIVWQDVFDDQVELQPGTVVEVWKSENYLNELAQVTASGFP
AILSAPWYLDLISYGQDWRNYYKAEPLNFEGSEKQKQLVIGGEACLWGEYVDATNLIPRL
WPRASAVGERLWSPRIITNLENAYRRLAVHRCRMVSRGIAAQPLFTGYCNYENKMEK
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgccggggtccccgcgtcgcgccccggggctgctgctgcaggcgctggtggcgatggtg
tcgctggccctggtggcccccttcgggctgcaacccgcgctgtggcccatgccgcgctcg
gtgcaggtgttcccgcggctgctgtacatctccccggagaacttccagatcgacaacagc
cccaattccaccgcgggcccctcctgctcgctgctgctggaggcgtttcggcgatattac
aactatatttttggtttctacaagagacatcatggccctgctaaatttcaagataaacca
cagttagagaagcttctggtcttcattaacctcgaaccgcagtgtgatgccttccctagt
atgtcatcagatgagtcctattctctacttgtacaagaaccagtagctctcctcaaggcc
aacgaagtttggggagcactaagaggtttggagacctttagccagttggtttaccaggac
gcttatgggacttttaccatcaatgaatccactattgctgattctccaagattccctcat
agaggaattctaattgatacatccagacactacctgcctgtgaagacaatttttaaaact
ctggatgccatggcttttaataagtttaacgtccttcactggcacatagtggacgaccag
tctttcccttatcagagtatcacttttcctgagctaagcaacaagggaagctattctttg
tctcatgtctatacaccaaacgacatccatatggtacttgaatatgcccggctccgaggg
attcgagtcataccagaattcgatagccccggccatacacagtcttgggggaaaggtcag
aaaaaccttctaactccatgtttcattcaaaaaattagaactcaaaaggttggacctgta
gacccaagtctaaatacaacatacgtattctttgacacattcttcaaagaaatcagcagg
gtgtttccagaccagtttatccacttgggaggagatgaagtggaatttgaatgttgggca
tcaaacccaaacatccaaaatttcatgaagaaaaagggctttggcaacaattttagaaga
ctagaatccttttatatcaaaaagattttggatattatcacatccttaaagaagagctcc
attgtttggcaagacgtttttgatgatcaagtggagcttcagccgggcacggtagttgaa
gtgtggaaaagtgaaaattacttaaatgaattagcacaagtcacagcatccggcttccct
gccatcctttctgctccttggtacttagacctgatcagctacgggcaagactggagaaac
tactataaagcggagccccttaactttgaaggttcggagaagcagaaacaacttgttatt
ggtggagaggcttgcctatggggagaatatgtggatgcaactaaccttattccaagacta
tggcctcgggcaagcgctgttggtgagaggctctggagccctagaattatcaccaacctg
gaaaacgcctacagacgactggcagtgcaccgctgtagaatggtcagccgcggaatagct
gcacaacctctctttactggatattgtaactacgagaataaaatggaaaagtga

DBGET integrated database retrieval system