KEGG   Rattus norvegicus (rat): 29470
Entry
29470             CDS       T01003                                 

Gene name
Mecr, Nrbf1
Definition
(RefSeq) mitochondrial trans-2-enoyl-CoA reductase
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00061  Fatty acid biosynthesis
rno00062  Fatty acid elongation
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
Module
rno_M00085  Fatty acid elongation in mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    29470 (Mecr)
   00062 Fatty acid elongation
    29470 (Mecr)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     29470 (Mecr)
    1.3.1.-  
     29470 (Mecr)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Other DBs
NCBI-GeneID: 29470
NCBI-ProteinID: NP_058905
RGD: 3208
Ensembl: ENSRNOG00000028047
UniProt: Q9Z311
Position
5q36
AA seq 373 aa
MLVSRRLTGARARAPLLASLLEAWCRQGRTTSSYSAFSEPSHVRALVYGNHGDPAKVIQL
KNLELTAVEGSDVHVKMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVS
GLKPGDWVIPANAGLGTWRTEAVFSEEALIGVPKDIPLQSAATLGVNPCTAYRMLVDFEQ
LQPGDSVIQNASNSGVGQAVIQIASALGLKTINVIRDRPDIKKLTDRLKDLGADYVLTEE
ELRMPETKNIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSML
IFKDLKLRGFWLSQWKKNHSPDEFKELILILCNLIRQGQLTAPAWSGIPLQDYQQALEAS
MKPFVSLKQILTM
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgttggtcagccggcgactgacaggggcgcgagcccgggcacctctgcttgcgagtctc
ctcgaggcttggtgccgccagggcaggaccacctcctcctactccgctttctcggagccg
tcgcatgtgcgggcgctggtctatggcaaccacggggatccagccaaggtcatccaactg
aagaacctggagctcactgctgtggaaggatctgacgtccatgtgaagatgctggcagcc
cctatcaatccatctgacataaatatgatccaagggaactatggcctccttcccaagctg
cctgctgttggagggaatgaaggtgttggacaggtgatagcagtgggcagcagtgtgtct
ggattgaagccaggagattgggtgatcccagcaaatgctggtttgggaacctggcggact
gaggcggtgttcagtgaggaagcgctgattggagtccctaaggacatccctctccagagt
gctgccaccctaggtgtcaacccctgcacagcctacaggatgttggtggactttgaacag
ctacaaccaggggactctgtcatccagaatgcgtccaacagtggagtagggcaagcagtc
attcagatcgcctcagcccttggcctaaagaccatcaacgtgatccgagacagacctgac
atcaagaagctaactgacagactgaaggatctaggagctgattatgtcctcacagaggag
gagctaaggatgcccgagaccaaaaacatcttcaaggacctgccgctgccccgactggct
ctcaactgtgtcggtgggaagagttccacagagctgctccggcacctagcgcccggagga
accatggtgacctatggaggaatggccaagcagcctgtaacagcctctgtgagtatgctc
atttttaaggacctcaaacttcgtggcttttggttgtcccagtggaagaagaaccatagt
ccagatgagttcaaggagctgattctcattctctgcaacctcatccgccaaggccagctc
acagcccctgcctggtccgggattccactgcaggactaccagcaggctttggaagcctcc
atgaagccttttgtgtctttgaagcagattctcactatgtga

DBGET integrated database retrieval system