KEGG   Rattus norvegicus (rat): 294706
Entry
294706            CDS       T01003                                 

Gene name
Cd180, Ly78
Definition
(RefSeq) CD180 molecule
  KO
K06555  CD180 antigen
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    294706 (Cd180)
CD molecules [BR:rno04090]
 Proteins
  294706 (Cd180)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_11 FNIP
Other DBs
NCBI-GeneID: 294706
NCBI-ProteinID: NP_001099875
RGD: 1308170
Ensembl: ENSRNOG00000010266
UniProt: D3ZIP2
Position
2q12
AA seq 662 aa
MALDISCFLLVALFSASCQAIGSSDQRCTEKEVNKTYNCEHLGLSEIPGTLPNSTESLEF
SFNALPTIQKTTFSRLVNLTFLDLTRCQIYWIHEDTFQSQHRLETLVLTANPLIFMAETA
LTGPKALKHLFFIQTGISSIEFIPVHSQKALESLYLGSNHISSIRLPKDFPTEKLKVLDF
QNNAIHHLSKEDVSSLQQATNLSLNLNGNDITGIEPGAFKSTVFQSLNFGGTQSLLVIFK
GLQNSTIQSLWLGTFEDIDDDEDISSSMFEGLCEMSVERINLQKHHFFNITSNTFYCFSG
LQELDLTATHLTELPSGIVGLSKLKKLVLSANKFENLCQISASNFPSLTHLYIKGNTKRL
ELGSGCLETLEHLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLGLRTEAFKEC
PQLELLDLAFTRLHVKDAQSPFQNLHLLKVLNLSHCLLGSSNQHLLDGLPALRHLNLQGN
RFPNGNIQKTNPLQALGSLEILILSFCDLSSIDHQAFINLKIMNHVDLSHNRLTSSSIEA
LSHLKGIYLNLASNRISIIPPSLLPVLSQQRTINLRQNPLDCTCSNIYFLEWYKENMQKL
EDIEDTFCANPPLLRGVKVSDVMLSCSMAAVGIFFLIVFLLLFAVLLIFAVKRFLRWKYQ
HI
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggctctggacatcagctgcttccttttagtggctctcttctcagccagctgccaagcc
atcggatcctcagatcagaggtgcactgagaaagaagtcaacaaaacatacaactgtgaa
catttaggtctcagtgaaattcctggcactctaccaaactcaacagaatctttggagttc
agctttaatgccttgcctacgattcaaaagacgactttcagcagactcgtaaatctcacc
ttcctggatttaaccaggtgccagatttactggatacatgaagatactttccaaagccaa
catcggttagagacacttgtgctaactgcaaatcccctgatatttatggcagagacagca
cttactgggcctaaggcactgaagcatctgttcttcatccaaacaggaatatccagtatt
gagtttatcccagtgcatagtcaaaaagccttggaaagcctctatcttggaagcaaccat
atttcctccattagactccccaaagatttcccaacagagaagctgaaggtcctggatttt
cagaataatgctatccatcacctgtcgaaagaagacgtgagctctctacagcaagccact
aatctgagcctgaacttaaatggaaacgacattacaggaatagagcccggggctttcaag
tcaactgtcttccaaagtttgaacttcggagggactcaaagcttgcttgttatcttcaag
ggtctgcagaactctactatccagtctctctggctggggacatttgaggacattgatgac
gacgaagatattagttcttccatgtttgagggcctctgtgaaatgtctgttgagagaatc
aacctacagaagcatcacttcttcaacatcacttccaacacattctactgcttcagcggt
ctccaggagctggacctaacagccacccacctgacagaattaccgtctgggattgtggga
ctaagcaagctcaagaaattagttcttagtgcaaataagtttgagaatttgtgccaaatc
agtgcttccaatttcccctcccttacacacctttacatcaaaggcaacacaaagagactt
gaacttggttcgggctgtttagaaaccctagaacaccttcgtgagcttgacctaagccat
gatgacattgaaacttctgattgctgcaacctgcaactcagaaacctgtctcacctacag
agcctgaacctgagctacaatgaacccctgggcctcaggactgaggccttcaaagaatgt
cctcagctagaactgctagacttggcatttacccgactccatgttaaagatgcacaaagt
cctttccagaacctccatctcttgaaggtgctaaatctctcccactgcctccttggctcc
agcaatcagcatctccttgatggcctgccagcactccggcatctgaatttacagggaaat
cgctttccaaatgggaatatccaaaagaccaacccacttcaagcactgggaagcctagaa
atcctgattttatcgttttgtgatctctcctccattgaccatcaagccttcatcaatctg
aagataatgaatcatgtagaccttagtcacaacaggctgacatccagtagtattgaggcc
cttagtcatcttaaggggatctacctcaatctagcttccaatcgcattagcatcatcccg
cccagtctcctccccgtgttgtcccagcagaggaccattaatttaagacaaaatcccctt
gactgcacttgctcaaacatttactttttagaatggtacaaagaaaacatgcaaaaactc
gaagacatagaggacactttttgcgcaaatcccccattgttgaggggagtcaaggtctct
gacgtcatgctgtcctgtagtatggcagctgtaggcattttctttctcattgtattcttg
ctcttgtttgctgttttgttgatttttgcagtgaaacgttttctcaggtggaaataccaa
cacatttag

DBGET integrated database retrieval system