KEGG   Rattus norvegicus (rat): 29473Help
Entry
29473             CDS       T01003                                 

Gene name
Aoc3, SSAO
Definition
(RefSeq) amine oxidase, copper containing 3
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00410  beta-Alanine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    29473 (Aoc3)
   00350 Tyrosine metabolism
    29473 (Aoc3)
   00360 Phenylalanine metabolism
    29473 (Aoc3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    29473 (Aoc3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     29473 (Aoc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2 DUF1965
Motif
Other DBs
NCBI-GeneID: 29473
NCBI-ProteinID: NP_113770
RGD: 62058
Ensembl: ENSRNOG00000051307
Vega: OTTRNOG00000000812
UniProt: O08590
Position
10q31
AA seq 763 aa AA seqDB search
MTQKTTLVLLALAVITIFALVCVLLAGRSGDGGRLSQPLHCPSVLPSVQPQTHPGQSQPF
ADLSPEELTAVMSFLIKHLGPGLVDAAQARPSDNCVFSVELQLPAKAAALAHLDRGGPPP
VREALAIIFFGGQPKPNVSELVVGPLPHPSYMRDVTVERHGGPLPYYRRPVLTREYQDIQ
EMIFHRELPQASGLLHHCCFYKRQGHNLLKMTTAPRGLQSGDRATWFGIYYNLSGAGFYP
HPIGLELLVDHKALDPALWTIQKVFYQGRYYESLTQLEDMFEAGLVNVVLVPDNGTGGSW
SLKSSVPPGRAPPLQFHPEGPRFSVQGSQVRSSLWAFSFGLGAFSGPRIFDIRFQGERVA
YEISVQEAIALYGGNSPASMSTCYMDGSFGIGKYSTPLTRGVDCPYLATYVDWHFLLESQ
TPKTLRDAFCVFEQNQGLPLRRHHSDFYSHYFGGVVETVLVVRSVATLLNYDYVWDMVFH
SNGAIEVKFHATGYITSAFFFGAGEKFGNRVAEHTLGTVHTHNAHFKVDLDVAGLKNWAW
AEDLAFVPMNVPWQPEFQMQRLQVTRKLLETEEEAAFPLGNATPRYLYLASNHSNKWGHR
RGYRIQILSFAGKPLPQESPIEKAFTWGRYHLAVTQRKEEEPSSSSIYNQNDPWTPTVDF
TDFISNETIAGEDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSP
DSIYFRKDQDVTDCEVNSLACLSQTANCVPDLPAFSHGGFTYK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaagaccaccctagtgctccttgccctggctgtcatcaccatcttcgctttg
gtttgcgtcttgctagctggcaggagcggagatgggggcagactgagccaacctcttcat
tgcccttccgttcttcctagcgtccagccccagacacaccctggccagagccagccgttt
gcagacctgagccctgaggagctgacagctgtgatgagctttctgatcaagcacctgggg
ccagggctggtggatgcagcccaggctcgaccctcggacaactgtgtcttctcagtagag
ttgcagctgcctgccaaggctgcagccctggcccacctggacagaggggggcccccaccc
gtgcgggaggcactggccatcatcttctttggtggacaacccaagcctaatgtgagcgag
ttggtggtggggcccctgcctcacccctcatacatgcgggatgtgactgtggagcgtcat
ggcggccccctgccctattaccggcgtcctgtgctgaccagagagtatcaggatatccag
gagatgatcttccacagagagctgccccaagcgtctggtctcctccatcactgttgcttc
tacaaacgccaaggacacaacctgctaaaaatgactacagccccccgtggtttgcaatca
ggggaccgggccacctggtttggcatatattacaatctctcaggggctgggttttaccct
caccccattggcttagagcttctggtagatcacaaggccctggatcctgccctgtggacc
atccagaaggtattctaccaaggccgttactatgagagtctgactcagctggaggacatg
tttgaggctggcctggtgaatgtggttttggtcccagacaatggcacaggtgggtcctgg
tctctgaagtcttcagtgccaccaggccgagctcctcctctgcagttccatcctgaggga
ccccgtttcagcgtccaggggagtcaagtgagatcctccttgtgggctttttcttttggt
cttggagctttcagtggcccaaggatctttgatatccgctttcaaggggagagggtggcc
tatgaaatcagtgtccaggaggccatagccctctatggtggtaattccccggcatcaatg
tcgacctgctatatggacggaagctttggcattggcaaatactctaccccgctgacccga
ggggtagactgtccataccttgccacctatgtggactggcacttccttctggagtctcag
acccccaagacactacgtgatgcgttttgcgtgtttgaacagaaccagggcctcccgctc
cggcgacaccactcagatttctactcccactattttgggggcgttgtggagacagtgctt
gtggtcagatccgtggctaccttgctcaattatgactatgtgtgggacatggttttccac
tccaatggggccatagaagtcaaattccacgccacgggctatatcacctcggctttcttc
ttcggtgctggcgagaagtttgggaaccgagttgccgagcacacactgggcactgtacac
acccacaacgctcacttcaaagtggacttggatgtggcagggttgaagaactgggcctgg
gcagaggatttggcttttgtccctatgaatgtaccttggcaaccggagttccagatgcag
aggctgcaggtgactcggaagctgctggagacagaagaggaggctgccttcccactggga
aatgccaccccacgctacctgtacctggccagtaaccacagcaacaagtggggtcacagg
cgaggctaccgcatccagatactcagctttgctgggaagccactgccccaggaaagcccc
atagagaaagccttcacctggggcaggtatcacttggctgtgacccagaggaaggaggag
gagcccagcagttctagcatctacaaccagaatgacccgtggacccccactgtggacttc
actgactttatcagcaatgagaccattgctggcgaggacttggtagcctgggtgacagct
ggctttttgcacatcccacatgcggaagacattcccaacacggtgaccgtagggaacggg
gtgggtttcttcctccggccgtataacttctttgatgaggacccctccttctactcaccc
gactccatctatttccggaaggaccaggatgtcacagactgtgaggtcaactccctggct
tgcctgtctcagactgccaactgtgtccccgacctccctgccttctcccatgggggcttt
acttataaataa

DBGET integrated database retrieval system