KEGG   Rattus norvegicus (rat): 294744Help
Entry
294744            CDS       T01003                                 

Gene name
Gpx8, RGD1307506
Definition
(RefSeq) glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    294744 (Gpx8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    294744 (Gpx8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    294744 (Gpx8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    294744 (Gpx8)
   05016 Huntington disease
    294744 (Gpx8)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     294744 (Gpx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 294744
NCBI-ProteinID: NP_001099881
RGD: 1307506
Ensembl: ENSRNOG00000010461
UniProt: D3ZPW7
Position
2q14
AA seq 209 aa AA seqDB search
MEPLGAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRINSFYSFEVKDAKGRMV
SLEKFKGKASLVVNVASDCRFTDKSYETLRELHKEFGPYHFNVLAFPCNQFGESEPKSSK
EVESFARKNYGVTFPIFHKIKILGPEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPLEAIRPHVSQMIGQIILKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctcggtgcctacccactaaaatgttccgggcccaaagcaaagatatttgca
gttttgctatctatggttctgtgcaccgtgatgctttttctccttcagttaaaattcctg
aagccgagaatcaacagcttctactcctttgaagtgaaggatgccaaaggaaggatggtg
tctctggaaaagttcaaaggcaaagcttccctagttgtaaacgtggctagtgactgccgg
ttcacagacaagagttacgagaccctcagggagctgcacaaggagtttgggccctatcac
ttcaacgtcctggctttcccgtgcaatcagtttggagaatcggagcccaagtccagcaag
gaggtagaatcttttgcaagaaaaaactacggagtcacattccccatcttccacaagatt
aagattttagggccggaagcagaacctgcgtttagatttcttgttgattcttccaagaag
gaaccaaggtggaacttttggaagtatctggtcaaccctgagggacaagtcgtgaagttc
tggaggccagaagaaccccttgaagccatcagacctcatgtgtcacaaatgattgggcaa
atcattcttaaaaagaaagaggatctatga

DBGET integrated database retrieval system