KEGG   Rattus norvegicus (rat): 29477Help
Entry
29477             CDS       T01003                                 

Gene name
Mapt, Mtapt, RNPTAU, Tau, pTau
Definition
(RefSeq) microtubule-associated protein tau
  KO
K04380  microtubule-associated protein tau
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29477 (Mapt)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29477 (Mapt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    29477 (Mapt)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29477 (Mapt)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29477 (Mapt)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29477 (Mapt)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    29477 (Mapt)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     29477 (Mapt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin-binding Tmemb_cc2
Motif
Other DBs
NCBI-GeneID: 29477
NCBI-ProteinID: NP_058908
RGD: 69329
Ensembl: ENSRNOG00000005133
Vega: OTTRNOG00000002190
UniProt: D3ZKD9 A0JN25
Position
10q32.1
AA seq 374 aa AA seqDB search
MAEPRQEFDTMEDQAGDYTMLQDQEGDMDHGLKAEEAGIGDTPNMEDQAAGHVTQARVAG
VSKDRTGNDEKKAKGADGKTGAKIATPRGAATPGQKGTSNATRIPAKTTPSPKTPPGSGE
PPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAP
VPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQ
IVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGG
NKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLAT
LADEVSASLAKQGL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccccgccaggagtttgacacaatggaagaccaggccggagattacactatg
ctccaagaccaagaaggagacatggaccatggcttaaaagctgaagaagcaggcatcgga
gacaccccgaacatggaggaccaagctgctgggcatgtgactcaagctcgagtggccggc
gtaagcaaagacaggacaggaaatgacgagaagaaagccaagggcgccgatggcaaaacg
ggggcgaagatcgccacacctcggggagcagccactccgggccagaaaggcacatccaat
gccaccaggatcccagccaagaccacacccagcccaaagactcctccaggatcaggtgaa
ccaccaaaatccggagaacgaagcggctacagcagccccggctcgcccggaacccctggc
agtcgctcccgtaccccatccctaccaacgccgcccacccgagagcccaaaaaggtggca
gtggttcgcactccccctaagtcaccgtctgccagtaagagccgcctacagactgcccct
gtgcccatgccagacctaaagaacgtcaggtccaagattggctccactgagaacctgaag
caccagccgggaggcggcaaggtgcagataattaataagaagctggatcttagcaacgtc
cagtccaagtgtggctcaaaggacaatatcaaacacgtcccgggcggaggcagtgtgcaa
atagtctacaagccagtggacctgagcaaggtgacctccaagtgtggttccttagggaac
atccatcacaagccaggaggtggccaggtagaagtaaaatcagagaagctggacttcaag
gatagagtccagtcgaagattggctccttggataacatcacccatgtccctggaggaggg
aataagaagattgaaacccacaagctgaccttcagggagaatgccaaagccaagacagac
catggagcagaaatcgtgtacaagtcacctgtggtgtctggggacacatctccacggcac
ctcagcaacgtctcctccacgggcagcatcgacatggtggactctccacagcttgccacg
ttagccgatgaagtgtccgcctctttggccaagcagggtttgtga

DBGET integrated database retrieval system