KEGG   Rattus norvegicus (rat): 29477
Entry
29477             CDS       T01003                                 

Gene name
Mapt
Definition
(RefSeq) microtubule-associated protein tau
  KO
K04380  microtubule-associated protein tau
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29477 (Mapt)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29477 (Mapt)
   05012 Parkinson disease
    29477 (Mapt)
   05022 Pathways of neurodegeneration - multiple diseases
    29477 (Mapt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    29477 (Mapt)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29477 (Mapt)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29477 (Mapt)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29477 (Mapt)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    29477 (Mapt)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     29477 (Mapt)
SSDB
Motif
Pfam: Tubulin-binding Tmemb_cc2
Other DBs
NCBI-GeneID: 29477
NCBI-ProteinID: NP_058908
RGD: 69329
Ensembl: ENSRNOG00000005133
Vega: OTTRNOG00000002190
UniProt: A0JN25 D3ZKD9
Position
10
AA seq 374 aa
MAEPRQEFDTMEDQAGDYTMLQDQEGDMDHGLKAEEAGIGDTPNMEDQAAGHVTQARVAG
VSKDRTGNDEKKAKGADGKTGAKIATPRGAATPGQKGTSNATRIPAKTTPSPKTPPGSGE
PPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAP
VPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQ
IVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGG
NKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLAT
LADEVSASLAKQGL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggctgaaccccgccaggagtttgacacaatggaagaccaggccggagattacactatg
ctccaagaccaagaaggagacatggaccatggcttaaaagctgaagaagcaggcatcgga
gacaccccgaacatggaggaccaagctgctgggcatgtgactcaagctcgagtggccggc
gtaagcaaagacaggacaggaaatgacgagaagaaagccaagggcgccgatggcaaaacg
ggggcgaagatcgccacacctcggggagcagccactccgggccagaaaggcacatccaat
gccaccaggatcccagccaagaccacacccagcccaaagactcctccaggatcaggtgaa
ccaccaaaatccggagaacgaagcggctacagcagccccggctcgcccggaacccctggc
agtcgctcccgtaccccatccctaccaacgccgcccacccgagagcccaaaaaggtggca
gtggttcgcactccccctaagtcaccgtctgccagtaagagccgcctacagactgcccct
gtgcccatgccagacctaaagaacgtcaggtccaagattggctccactgagaacctgaag
caccagccgggaggcggcaaggtgcagataattaataagaagctggatcttagcaacgtc
cagtccaagtgtggctcaaaggacaatatcaaacacgtcccgggcggaggcagtgtgcaa
atagtctacaagccagtggacctgagcaaggtgacctccaagtgtggttccttagggaac
atccatcacaagccaggaggtggccaggtagaagtaaaatcagagaagctggacttcaag
gatagagtccagtcgaagattggctccttggataacatcacccatgtccctggaggaggg
aataagaagattgaaacccacaagctgaccttcagggagaatgccaaagccaagacagac
catggagcagaaatcgtgtacaagtcacctgtggtgtctggggacacatctccacggcac
ctcagcaacgtctcctccacgggcagcatcgacatggtggactctccacagcttgccacg
ttagccgatgaagtgtccgcctctttggccaagcagggtttgtga

DBGET integrated database retrieval system