KEGG   Rattus norvegicus (rat): 29478
Entry
29478             CDS       T01003                                 

Gene name
Ndufs6, Ip13dis, Ndub13, RATIp13dis
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit S6
  KO
K03939  NADH dehydrogenase (ubiquinone) Fe-S protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29478 (Ndufs6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    29478 (Ndufs6)
  09159 Environmental adaptation
   04714 Thermogenesis
    29478 (Ndufs6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29478 (Ndufs6)
   05012 Parkinson disease
    29478 (Ndufs6)
   05016 Huntington disease
    29478 (Ndufs6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29478 (Ndufs6)
SSDB
Motif
Pfam: zf-CHCC Thiolase_C
Other DBs
NCBI-GeneID: 29478
NCBI-ProteinID: NP_062096
RGD: 3156
UniProt: P52504
Position
2q12
AA seq 116 aa
MAAALTFRRLLALPRAARGFGVRVSLSGEKITHTGQVSDGKDYRGIRFVDRQKEVNENFA
IDLIAQQPVNEVDRRIIACDGGGGALGHPKVYINLDKETKTGTCAYCGLQFKQQHH
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcggcggcgctgaccttccgccgtctgttggctctccctagggctgcccggggtttc
ggggtgcgagtgtcgctgagcggggagaagatcacgcataccggccaggtgtctgatgga
aaagactacagggggattcgttttgtagatcgtcagaaagaggtgaatgagaactttgcc
attgatttgatagcacaacaacctgtgaatgaggtggaccgtcgtatcatagcctgtgat
ggagggggtggagccttgggccaccccaaggtgtatataaacctggacaaagaaacaaaa
acgggtacgtgtgcctactgcggcctgcagttcaagcagcagcatcactag

DBGET integrated database retrieval system