KEGG   Rattus norvegicus (rat): 29479Help
Entry
29479             CDS       T01003                                 

Gene name
Odf2
Definition
(RefSeq) outer dense fiber of sperm tails 2
  KO
K16479  outer dense fiber protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29479 (Odf2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    29479 (Odf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mt_ATP-synt_D DUF3584 ADIP CENP-F_leu_zip TMF_DNA_bd TMF_TATA_bd GAS
Motif
Other DBs
NCBI-GeneID: 29479
NCBI-ProteinID: NP_001138477
RGD: 3229
Ensembl: ENSRNOG00000014584
UniProt: Q6AYX5 G3V7X0
Position
3p12
AA seq 705 aa AA seqDB search
MGELPTGCRKRRRKRGGAAAGAGLHPPRRLHGTTLASDFNDFIRRRFWAQPCRSWFPSCG
KNGVTSLTQKKVLRTPCGAPSVTVTKSHKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPS
SEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFL
EERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAE
MDGAAAAKQVMALKDTIGKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR
EQHCKELCLKVPECARQHRPGRERQEDCQDSERLMEQQGALLKRLAEADSEKARLLLLLQ
DKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLER
SGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADKDL
YVAEALSTLESWRSRYNQVVKDKGDLELEIIVLNDRVTDLVNQQQSLEEKMREDRDSLVE
RLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVMK
TRLEADEVAAQLERCDKENKMLKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAE
CQDQLQGYERKNIDLTAIISDLRSRVRDWQKGSHELARAGARLPR
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagctgccgaccggttgtcggaaaaggaggcggaagcggggaggagccgccgcg
ggagccggactgcatccgccgcggcgtctccatggcacgaccctggcctccgacttcaac
gacttcataaggagacggttctgggcgcagccgtgccgctcttggtttccatcgtgtggg
aagaacggagtaacgagtctcacacagaaaaaagtcttgagaacaccttgtggcgcaccc
agtgtaactgtgacgaaatctcataagcgcggaatgaaaggggacaccgtgaatgtacgg
cggagtgtccgggtgaaaaccaagaatccacctcattgcctggagatcacaccaccatct
tcagaaaagctggtctcggtgatgcgattgagtgacctttctacagaagacgacgattct
ggtcactgtaagatgaaccgttacgataagaagattgacagtctaatgaacgcggtcggt
tgtctcaaatctgaggtcaagatgcagaaaggtgaacgccaaatggccaaaaggttcctg
gaggagaggaaggaagaactggaggaggtagcacatgagcttgcagagacggagcatgag
aacacagtgctcagacacaacatcgagcgcatcaaggaggagaaggacttcaccatgctt
caaaagaaacacctccagcaggagaaggaatgcctcatgtccaaactggtggaggctgaa
atggatggggcggctgctgccaaacaagtcatggccttgaaggataccatcgggaagctg
aaaaccgagaaacagatgacttgcaccgacatcaacaccttaacgaggcagaaggaactt
ctcctgcagaagctgagcacctttgaagagaccaaccgcaccctccgagatctgttgagg
gagcagcactgcaaagagctgtgcctgaaagttcctgaatgtgcgaggcagcacaggcct
gggagggagaggcaggaggattgtcaggattccgagagactaatggagcaacaaggtgca
ttactgaaacgtctggcagaggccgactcagagaaagcgcgcctgctgttactactgcaa
gacaaggacaaggaagtggaagaactcctccaggagatacaatgtgagaaggctcaagca
aagacagcgtctgagctctccaagtccatggagtccatgcgggggcatttgcaggcacag
cttcgctgcaaagaggctgagaacagccgcctgtgcatgcagatcaagaatttagagcgc
agtgggaaccagcacaaggcggaagtagaggccatcatggagcagctaaaggaactgaag
caaaagggagaccgagacaaagagaccctgaagaaggccatccgagcccagaaggagcga
gctgagaagagtgaggagtatgccgagcagctacatgtgcagctggccgacaaggacctt
tatgttgctgaagctttatctactctggagtcatggaggagccgttacaaccaagttgtg
aaagacaaaggagaccttgagttggagatcattgtcctaaatgaccgggtgacagatctt
gtaaaccaacaacagagcttggaggagaagatgcgggaagaccgggacagcttggtagag
agactgcaccggcaaactgctgagtattctgccttcaagctagagaacgagaggctcaag
gctagctttgcccctatggaggacaagctcaatcaggctcacttggaggtccagcaactg
aaggcatcagtgaagaactacgaggggatgatcgacaactacaagagccaggtgatgaaa
acaagattggaggctgacgaagtggctgcgcagctagagcgctgcgacaaagagaacaag
atgcttaaagacgagatgaacaaagaaatcgaggcggcccgtcggcagttccagtcacag
ctggctgacctacaacagctgcctgacatcctcaagatcacggaggccaagctggctgag
tgtcaagaccagctgcagggctacgagaggaagaacatcgacctcacagccatcatttca
gacctgcgcagccgggtaagggactggcagaagggatcccacgaactggcccgagcaggg
gcccgcttaccgagatga

DBGET integrated database retrieval system