KEGG   Rattus norvegicus (rat): 294790Help
Entry
294790            CDS       T01003                                 

Gene name
Skp2, RGD1562456
Definition
(RefSeq) S-phase kinase associated protein 2
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04120  Ubiquitin mediated proteolysis
rno04150  mTOR signaling pathway
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    294790 (Skp2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    294790 (Skp2)
   04150 mTOR signaling pathway
    294790 (Skp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    294790 (Skp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    294790 (Skp2)
   05203 Viral carcinogenesis
    294790 (Skp2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    294790 (Skp2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    294790 (Skp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    294790 (Skp2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     294790 (Skp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box F-box_5
Motif
Other DBs
NCBI-GeneID: 294790
NCBI-ProteinID: NP_001099886
RGD: 1562456
Ensembl: ENSRNOG00000059059
UniProt: B2GUZ0
Position
2q16
AA seq 423 aa AA seqDB search
MHRKHLQEIPDQSSNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPHGLLSNLG
HPQSPPRKRLKSKGSDKDFVIIRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLRV
SGVCKRWYRLSLDESLWQSLDLAGKNLHPDVTVRLLSRGVVAFRCPRSFMEQPLGESFSS
FRVQHMDLSNSVINVSNLHGILSECSKLQNLSLEGLQLSDPIVTTLAQNENLVRLNLCGC
SGFSESAVATLLSSCSRLDELNLSWCFDFTEKHVQAAVAHLPDTLTQLNLSGYRKNLQKT
DLCTLIKRCPNLVRLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLREALPRLQINCAYFTSIARPTMDNKKNPEIWGIKCRLTLQK
PSL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcataggaagcaccttcaggagattccggaccagagtagcaacgtcaccaccagcttc
acgtggggatgggattccagcaagacttctgaactgctgtcaggcatgggtgtctctgcc
ttggagaaggaggaggtggacagtgagaacatcccacatggactgctctcaaacctcggc
cacccccagagccctccaaggaaaaggctaaagagcaaagggagtgacaaagactttgtg
atcattcgtcggcctaagctcaatcgagagaactttccaggtgtttcctgggactccctt
ccagatgagctgctcctgggaatcttttcctgtctgtgcctccctgagcttttgagagtc
tctggagtttgcaagaggtggtaccgcctctcgctcgatgagtctctctggcagtcccta
gacctcgcaggcaaaaatctgcacccagacgtgacagtgcgcctgctctctcgaggagtc
gtggccttccgctgcccacggtcgtttatggagcagccactgggcgaaagcttcagctct
ttccgtgtacagcacatggacctgtcgaactcagttataaatgtgtcaaacctccacggg
attctgtccgagtgctccaagctgcagaatctgagtctggaaggcctgcagctttcagat
cccattgtcactactcttgcgcagaatgaaaacttggtgcgactgaacctttgtgggtgc
tctggattttctgagtctgccgtggccaccctgctgagcagctgctccagactggatgaa
ctgaacctctcctggtgctttgacttcactgagaagcatgtgcaagcggccgtggcacat
ttaccagatacgctcacccagctgaacctcagcggctaccgaaagaacctccagaaaaca
gatctttgtaccctaattaaacgatgccccaacctcgtccgcctcgacttaagtgacagt
atcatgctgaagaatgactgctttccagaattttttcaactcaactacctccaacacctc
tcgctcagccggtgctacgatataatacctgagacgctacttgaactcggagaaatcccc
acactaaaaacactacaagtttttgggatcgtgccagacgggacccttcagctactgaga
gaagctcttcctcgcctgcagattaattgtgcctatttcacctccattgcaaggccaact
atggacaacaagaagaacccggagatttggggtatcaaatgccgactgaccctgcaaaag
cccagtttatga

DBGET integrated database retrieval system