KEGG   Rattus norvegicus (rat): 294800
Entry
294800            CDS       T01003                                 

Gene name
Rad1
Definition
(RefSeq) cell cycle checkpoint protein RAD1
  KO
K02830  cell cycle checkpoint protein [EC:3.1.11.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    294800 (Rad1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    294800 (Rad1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     294800 (Rad1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    294800 (Rad1)
   Rad17-Mec3-Ddc1 complex
    294800 (Rad1)
SSDB
Motif
Pfam: Rad1 DUF1140
Other DBs
NCBI-GeneID: 294800
NCBI-ProteinID: NP_001099889
RGD: 1306496
Ensembl: ENSRNOG00000018063
UniProt: D3ZC52
Position
2
AA seq 280 aa
MPLLTQYNEDEYEQYCLVASLDNVRNLSTVLKAIHFKEHATCFATKNGIKVTVENAKCVQ
ANAFIQADVFQEFIIQEESVTFRINLTILLDCLSIFGSSPTPGTLTALRMCYQGYGHPLM
LFLEEGGVVTVCKITTQEPEDTLDFDFCSTNVMNKIILQSEGLREAFSELDMTGDVLQIT
VSPDKPYFRLSTFGNAGNSHLDYPKDSDLVEAFHCNKTQINRYKLSLLKPSTKALALSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcctctcctaacccagtacaatgaggatgagtacgaacagtactgcttagtggccagc
cttgacaacgttaggaatctctccactgtcttgaaagccattcacttcaaagaacacgcc
acgtgttttgctactaaaaatggaatcaaggttaccgtggaaaatgcaaagtgtgtgcaa
gccaatgcctttattcaggctgatgtatttcaagaatttatcattcaggaagaatccgtt
acttttcgaattaacttaactatccttttagactgtttatctatttttggatcaagtcct
acaccagggactttaactgcacttcggatgtgttaccaaggttatggtcacccactgatg
ctatttctagaagaaggaggagtagtgacggtctgcaaaattaccactcaggagcctgag
gacacactggattttgatttctgcagcaccaatgttatgaataaaattatcctgcagtcc
gagggactccgggaagccttttctgagttggacatgacaggtgatgtcctacagatcacc
gtgtctcctgacaagccctacttcaggttgtctacttttggaaatgcaggaaactcccat
cttgactatcccaaagattcggatttggtggaagcatttcactgtaataagacccagatc
aacagatacaaactttctttactgaaaccttctacaaaggcattagctttatcttgtaaa
gtgtctattcggacagataatcgaggattcctctcattacagtacatgattagaaatgag
gatgggcaaatatgctttgtggaatattactgctgccctgatgaagaagtccctgagtct
tga

DBGET integrated database retrieval system