KEGG   Rattus norvegicus (rat): 294807
Entry
294807            CDS       T01003                                 

Gene name
Rxfp3, GPCR135, RGD1311550, Rln3r1, Salpr
Definition
(RefSeq) relaxin/insulin-like family peptide receptor 3
  KO
K08397  relaxin family peptide receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    294807 (Rxfp3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    294807 (Rxfp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    294807 (Rxfp3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Relaxin
    294807 (Rxfp3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 294807
NCBI-ProteinID: NP_001008311
RGD: 1311550
Ensembl: ENSRNOG00000023126
UniProt: Q5Y986
Position
2q16
AA seq 476 aa
MPKAHLSMQVASATTAAPMSKAAAGDELSGFFGLIPDLLEVANRSSNASLQLQDLWWELG
LELPDGAAPGHPPGSGGAESADTEARVRILISAVYWVVCALGLAGNLLVLYLMKSKQGWR
KSSINLFVTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFL
TAMSVARYHSVASALKSHRTRGHGRGDCCGQSLGESCCFSAKVLCGLIWASAAIASLPNV
IFSTTINVLGEELCLMHFPDKLLGWDRQFWLGLYHLQKVLLGFLLPLSIISLCYLLLVRF
ISDRRVVGTTDGATAPGGSLSTAGARRRSKVTKSVTIVVLSFFLCWLPNQALTTWSILIK
FNVVPFSQEYFQCQVYAFPVSVCLAHSNSCLNPILYCLVRREFRKALKNLLWRIASPSLT
SMRPFTATTKPEPEDHGLQALAPLNATAEPDLIYYPPGVVVYSGGRYDLLPSSSAY
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgcccaaagcgcacctgagcatgcaagtggcttctgcaaccaccgcagcccccatgagt
aaggcagctgcgggtgatgagctctccggattcttcggcctgatcccagacttgctggag
gttgccaacaggagcagcaatgcgtcgctgcagcttcaggacttgtggtgggagctgggg
ctggagttgcccgacggtgcggcgcctgggcatcccccgggcagcggtggggcagagagc
gcggacacagaggccagggtacggatcctcatcagcgccgtttactgggtggtttgtgcc
ctgggactggctggcaacctgctggttctctacctgatgaagagcaaacagggctggcgc
aaatcctccattaacctctttgtcactaacctggcgctgactgactttcagtttgtgctc
actctgcccttctgggcggtggagaacgcactagatttcaagtggccctttggcaaggcc
atgtgtaagatcgtatctatggtgacatccatgaacatgtatgccagcgtcttctttctc
actgctatgagtgtggcgcgctaccactcggtggcctcagctctcaagagccatcggacc
cgcgggcatggccgtggcgactgctgcggccagagcttgggggagagctgctgtttctca
gccaaggtgctgtgtggattgatctgggcttctgccgcgatagcttcgctgcccaatgtc
attttttctaccaccatcaatgtgttgggcgaggagctgtgcctcatgcactttccggac
aagctcctgggttgggaccggcagttctggctgggtttgtaccacctgcagaaggtgctg
ctgggcttcctgctgccgctgagcatcatcagtttgtgttacctgttgctcgtgcgcttc
atctccgaccgccgcgtagtggggacaacggatggagcaacagcgcctggggggagcctg
agtacagccggcgctcggagacgctccaaggtcaccaagtcggtgaccatcgtagtcctt
tccttcttcttatgttggctgcccaaccaagcgctcaccacctggagcatcctcatcaag
ttcaacgtagtgcccttcagtcaggagtactttcagtgccaagtgtacgcgttcccagtc
agcgtgtgcctggcacactccaacagctgcctcaaccccatcctctactgcttagtgcgc
cgcgagttccgcaaggcgctcaagaacctgctgtggcgtatagcatcgccttcgctcacc
agcatgcgccccttcaccgccaccaccaagccagaacctgaagatcacgggctgcaggcc
ctggcgccacttaatgctactgcagagcctgacctgatctactatccacccggtgtggtg
gtctacagcggaggtcgctacgaccttctccctagcagctctgcctactga

DBGET integrated database retrieval system