KEGG   Rattus norvegicus (rat): 29482
Entry
29482             CDS       T01003                                 

Gene name
Slc1a2
Definition
(RefSeq) excitatory amino acid transporter 2 isoform a
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29482 (Slc1a2)
   04721 Synaptic vesicle cycle
    29482 (Slc1a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29482 (Slc1a2)
   05016 Huntington disease
    29482 (Slc1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29482 (Slc1a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   29482 (Slc1a2)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 29482
NCBI-ProteinID: NP_058911
RGD: 3697
Ensembl: ENSRNOG00000005479
UniProt: P31596 Q8K5B5
Position
3
AA seq 573 aa
MASTEGANNMPKQVEVRMHDSHLSSEEPKHRNLGMRMCDKLGKNLLLSLTVFGVILGAVC
GGLLRLAAPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPSEEANTTKAVISLLNETMNEAPEETKIVIKKGLEFKDGMN
VLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKII
AIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGT
ASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILD
GGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSV
NVVGDSFGAGIVYHLSKSELDTIDSQHRMHEDIEMTKTQSIYDDTKNHRESNSNQCVYAA
HNSVVIDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggcatcaaccgagggtgccaacaatatgcccaagcaggtggaagtgcgcatgcacgac
agccacctcagctccgaggagccaaagcaccgaaacctgggcatgcgcatgtgcgacaag
ctggggaagaacctcctgctctcactgactgtgtttggtgtcatcctgggagcagtatgt
ggcgggctgcttcgcttggcggctcccatccaccctgatgtggtcatgttgatagccttc
ccgggggacatcctcatgaggatgctgaagatgctcatcctccctctcatcatttccagt
ctcatcacagggctgtcagggctggatgctaaagccagcggccgcctaggcacgagagcc
atggtatattacatgtccacgaccatcattgccgctgtgctgggggtcatcctggtgttg
gccatccaccctgggaatcccaaactcaagaagcagctggggcctgggaagaagaacgac
gaggtgtccagcctggatgccttcctggatctcattagaaatctcttcccggagaacctg
gtacaagcctgtttccaacagattcagactgtgacaaagaaagttctggtggcacctcca
tccgaggaggccaatacaaccaaggcagtcatctccctgttgaatgagaccatgaatgag
gcccctgaagaaactaagatcgttatcaagaagggcctggagttcaaggacgggatgaat
gtcttaggtctgattggattctttattgctttcggcattgccatggggaagatgggtgag
caggccaagctgatggtggagttcttcaacattctgaacgagattgtcatgaagttagtg
atcatgatcatgtggtattccccgctgggtatcgcctgcttgatctgtgggaagatcatc
gccatcaaggacttagaagtggttgctaggcagctggggatgtacatgatcacagtgatc
gtgggcctcatcattcatgggggcatctttctccccttgatttactttgtagtgaccaga
aaaaacccattctccttttttgctggcattttccaagcctggatcactgccctgggaacc
gcttccagtgctggaactttgcctgtcaccttccgttgcttggaagataatctagggatt
gacaagcgtgtgaccagattcgtcctcccagtcggagcaaccattaacatggatggtaca
gccctttacgaagccgtggcagccatcttcatagcccagatgaatggggtcatcctggat
ggaggtcagatagtgactgtaagccttacagcaactctggcgagcattggtgcagccagt
attcccagcgccgggttggtcaccatgctcctcattctcacagctgtgggcctgccgaca
gaggacatcagtctgctggtggcagtggactggctgctggatagaatgagaacttcggtc
aatgtagtgggcgattcttttggggctgggattgtctatcacctttccaagtccgagctg
gacaccattgactcccaacaccgaatgcacgaagacatcgaaatgaccaagacgcagtcc
atttatgacgacacgaagaaccacagggaaagcaactctaatcagtgtgtctatgccgca
cacaactctgtcgtaatagatgagtgcaaggtaactctggcggccaatggaaagtcagct
gactgcagtgttgaggaagaaccttggaaacgtgaaaaataa

DBGET integrated database retrieval system