KEGG   Rattus norvegicus (rat): 29483
Entry
29483             CDS       T01003                                 

Gene name
Slc1a3
Definition
(RefSeq) excitatory amino acid transporter 1 isoform 1
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29483 (Slc1a3)
   04721 Synaptic vesicle cycle
    29483 (Slc1a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    29483 (Slc1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29483 (Slc1a3)
   04147 Exosome [BR:rno04147]
    29483 (Slc1a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   29483 (Slc1a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   29483 (Slc1a3)
SSDB
Motif
Pfam: SDF Yip1 MT
Other DBs
NCBI-GeneID: 29483
NCBI-ProteinID: NP_062098
RGD: 3698
Ensembl: ENSRNOG00000016163
UniProt: P24942 G3V846
Position
2
AA seq 543 aa
MTKSNGEEPRMGSRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVSAVIV
GTILGFALRPYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREGKIVQVTAADAFLDLIRNMFPP
NLVEACFKQFKTSYEKRSFKVPIQANETLLGAVINNVSEAMETLTRIREEMVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFD
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNEPEKPVADSE
TKM
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgacaaaaagcaacggagaagagcccaggatgggaagcaggatggaaagattccagcaa
ggggtgcgcaagcggacgctcctggccaagaagaaagttcagaacatcaccaaggaggat
gtgaagagctacctgtttcggaatgcctttgtgctactcaccgtcagcgctgtcattgtg
ggtacaatccttggatttgccctccgaccgtataaaatgagctaccgggaggtcaagtac
ttctcctttcctggggagcttctgatgcggatgctgcagatgttggtcttacccctgatc
atctccagtcttgtcacaggaatggcggccctagatagtaaggcatctgggaagatgggg
atgcgagctgtggtctattacatgactaccaccatcattgctgtggtgatcggcataatc
attgtcatcatcatccaccccggaaagggcacgaaagaaaacatgtacagagaaggtaaa
atcgtgcaggtgactgccgcagatgccttcctggatttaatcaggaacatgttcccaccc
aatctggtagaagcctgctttaaacagtttaaaaccagctatgagaagagaagctttaaa
gtgcccatccaggccaacgaaacactgttgggcgccgtgatcaacaacgtgtcagaggcc
atggagactctgacccggatccgggaggagatggtacccgttcctgggtctgtgaatggg
gtcaatgccctgggcctcgttgtcttctccatgtgcttcggcttcgtgatcggaaacatg
aaggagcaggggcaagcgctaagagagttcttcgactctctcaatgaagccatcatgaga
ttggtagcggtgataatgtggtatgcacctctgggcatcctcttcttgatcgcagggaag
attgttgagatggaagatatgggtgtgattggggggcagcttgccatgtatacagtgaca
gtcatcgtcggcctcctcattcatgccgtcatcgtcctgcctctcctctacttcctggta
acccggaagaacccctgggttttcattggagggttgctgcaagcactcatcacagccctg
gggacctcctcaagttctgccaccctgcccatcactttcaagtgcctggaagaaaacaat
ggtgtggacaaacgcatcaccagatttgtgcttcccgtgggggccaccattaacatggat
gggaccgccctctacgaggctttggccgccattttcatcgctcaagttaacaactttgac
ctgaattttggacagattataacaataagtatcacagccacagccgcaagcattggggca
gctggcattcctcaggccggtctagtcaccatggtcatcgtgctgacatctgtgggcctg
cccacggatgacatcacactcatcattgcagtggactggtttctggaccgcctccgaacc
accaccaacgtgctgggtgactccctcggggccgggattgttgaacacttgtcccgacat
gaactgaagaaccgagatgttgaaatggggaactccgtgattgaggagaatgaaatgaaa
aagccgtatcagctgattgcccaggacaatgaaccagagaaacccgtggcagacagcgaa
accaagatgtag

DBGET integrated database retrieval system