KEGG   Rattus norvegicus (rat): 29485Help
Entry
29485             CDS       T01003                                 

Gene name
Slc7a3, Atrc3, Cat3, Slc7a2, cat-3
Definition
(RefSeq) solute carrier family 7 member 3
  KO
K13865  solute carrier family 7 (cationic amino acid transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29485 (Slc7a3)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   29485 (Slc7a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Lig_chan
Motif
Other DBs
NCBI-GeneID: 29485
NCBI-ProteinID: NP_058913
RGD: 68342
Ensembl: ENSRNOG00000004133
Vega: OTTRNOG00000000595
UniProt: O08812
Position
Xq22
AA seq 619 aa AA seqDB search
MLWQALRRFGQKLVRRRLLELGMGETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKE
KAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILS
YVIGTASVARAWSSAFDNLIGNHISQTLKGTILLNMPHVLAEYPDFFALALVLLLTGLLV
LGANESGLVTKVFTGMNLLVLGFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSM
GSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSICFLAYF
GVSSALTLMMPYYKLQPESPLPEAFTYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVI
YAMAEDGLLFRVLARVHNGTHTPIVATVVSGVIAAFMAFLFELTDLVDLMSIGTLLAYSL
VSICVLILRYQPDQEMKNGEEEVELQEERTLEAEKLTVQALFCQVDSIPTLLSGRIVYVC
SSLLAVLLTVLCLVLTWWTTPLHSGDPVWVTVVVLILGLILGISGVIWRQPQNRTPLHFK
VPVVPLLPLVSIFVNVYLMMQMTADTWARFGVWMLIGFAIYFGYGIQHSVEEVKNHQTLP
KTRPQTIDLDLTTSCVHSI
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcaggcacttcgaagatttggtcaaaagctggtgcggagacgtttgctggag
ctgggcatgggtgaaacccgccttgccagatgcctgagcactctcgacttagtggccctg
ggtgtgggcagcacattaggtgcaggtgtgtatgtcctggctggtgaggtggccaaagag
aaagcaggaccatccattgtgatctgctttttggtggctgctctgtcctctgtgttggct
ggactgtgttatgctgagtttggtgcccgggtccccggctctggttctgcatacctctac
agttatgtcaccgtaggtgaactctgggccttcaccaccggctggaatctcattctctcc
tacgtcattggtacagccagtgtggcccgggcttggagctctgcttttgacaacctgatt
ggaaaccacatctctcagactctgaaggggaccatcttactgaacatgcctcatgttctt
gcagaatatccagatttctttgccttggcccttgtgttgctgctcactggattgctggtt
ttgggggctaatgaatccggcctggttaccaaagtgttcacagggatgaaccttttggtt
ctcgggtttgtcatcatctctggcttcattaagggagagctgagaaactggaagctcacg
aaagaggactattgcttgactatgagtgaatccaatggcacttgtagcttggattctatg
ggctctggaggtttcatgccttttggcttggaagggattctccgtggcgctgctacctgt
ttctatgccttcgttggttttgactgtattgcgaccactggggaagaggctcagaatccc
cagcgctccatccctatgggtattgtgatctcactgtccatctgctttttggcttatttt
ggtgtgtcatcagcactgacgctcatgatgccttactacaagcttcagcctgagagccct
ctgcctgaagcttttacctatgttggctgggagcctgcccgctacctggtggctattggc
tccctctgtgcactttctactagccttttgggctctatgtttcctatgcctcgggtgatc
tatgcgatggcagaagatggccttctgttccgtgtccttgctagggtccacaatggcaca
catacacccattgtggccactgtggtatctggtgttattgcagcattcatggcattcctc
tttgaactcactgatctcgtggacctcatgtcaatcgggactctgctcgcttactccctg
gtgtcaatttgtgttcttatcctcagatatcagcctgaccaagaaatgaagaacggtgaa
gaggaagtggaattgcaagaggagaggacactcgaagcagaaaagctgactgtccaggct
ctattttgccaagtcgactccatccccacactcctttctggccgaattgtctatgtttgc
tcatcactgcttgctgtactactaactgttctttgcctggtgctgacctggtggacaact
ccgcttcattctggagacccagtgtgggtcacagtggttgtgctgatcctggggctgatc
cttggaatttctggggtcatctggagacaaccacagaaccgcactccccttcattttaag
gtgcccgttgttcctctactcccactggtgagcatctttgtgaatgtttacctgatgatg
caaatgacagctgacacttgggcccgatttggggtctggatgctgattggatttgctatc
tacttcggctatgggatccaacacagcgtggaagaagttaagaatcatcaaactctaccc
aagacaaggccccaaactatagaccttgatctcaccacttcttgtgttcatagtatttga

DBGET integrated database retrieval system