KEGG   Rattus norvegicus (rat): 294912Help
Entry
294912            CDS       T01003                                 

Gene name
Sec62, Ab2-292, Tloc1
Definition
(RefSeq) SEC62 homolog, preprotein translocation factor
  KO
K12275  translocation protein SEC62
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    294912 (Sec62)
   04141 Protein processing in endoplasmic reticulum
    294912 (Sec62)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    294912 (Sec62)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   294912 (Sec62)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec62 DEP
Motif
Other DBs
NCBI-GeneID: 294912
NCBI-ProteinID: NP_001029301
RGD: 1308862
Ensembl: ENSRNOG00000009057
UniProt: Q7TP42
Position
2q24
AA seq 605 aa AA seqDB search
MMSAEQRHQALEVKYGQERERKPKCCPEERQEEHEMHSFNAIRVQILPGSNMYQTPTPLG
FLQVSSTRLQYLATQPHGQSNYEGSHPLQSRFPSFKGNFMGLKWGATELVGAGSGIGDAL
GPGGPGPFLSKGLTGVGDSEGWGPGICIYTPARDRNEDHRARPSAAPSPQPAAGYITGRE
PPHSRETSTAPPPLLAPRQKEPGGAANMAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCP
TKSTNMMGHRVDYFIASKAVECLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHR
ALKVMKMKYDKDIKKEKEKGKSESGKEDDKKSKKESIKEEKTKKEKEKKKDGEKEDSKKE
ETPGTPKKKETKKKFKLEPHDDQVFLDGNEVFVWIYDPVHIKTFVMGLILVIAVIAATLF
PLWPAEMRVGVYYLSVGAGCFVASILLLAIARCILFLIIWLITGGRHHFWFLPNLTADVG
FIDSFRPLYTHEYKGPKADLKKDEKSEAKKQHKSDSEEKSDSEKKEDEEGKGAPGDHGPE
GSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCDEEDDDKDGEMPKS
AQEKS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagctgaacaaagacaccaggctttggaagtgaaatatggacaggaaagagaa
aggaaaccaaaatgttgtccggaggaaaggcaagaagaacacgagatgcattccttcaat
gctatcagggtacagattcttccaggttccaacatgtaccaaacaccaacacctctagga
ttcctacaggtctccagtaccagactgcagtacttagctacccaacctcatggacagagc
aactacgagggttctcatcctctccagagtcgctttccatcttttaaagggaacttcatg
ggactgaagtggggtgccacggagcttgttggggcaggaagcggcataggtgacgctttg
ggtcccggtggtccaggtcctttcctcagcaaaggcctcaccggcgtcggtgactccgag
gggtggggcccggggatctgtatttacacgccagccagggacaggaacgaagaccacaga
gcccggccctcggctgcccccagcccacagcccgcggcgggttacataacgggccgcgag
ccgccgcactctcgcgagacttccaccgccccccctcccctgctcgctccacgtcagaag
gaaccgggcggagcggccaacatggcggaacgcaggcgacacaagaagcggatccaggaa
gttggtgaaccatctaaagaagagaaggctgtagccaagtatcttcgattcaactgtcca
acaaaatccaccaacatgatgggtcatcgggttgattattttattgcttcaaaagcagtg
gagtgcctcttggattctaaatgggcaaaggccaagaaaggagaggaagctttatttaca
accagggagtctgtggttgactactgcaacaggcttttaaagaaacagttttttcatcgg
gccctaaaagtaatgaaaatgaaatatgacaaagacataaaaaaagaaaaagaaaaagga
aaatctgaaagtgggaaagaagatgataaaaagagcaagaaagaaagtattaaagaagaa
aaaacaaaaaaggaaaaagaaaaaaagaaagatggtgaaaaggaagattccaaaaaggaa
gaaactccaggaactccaaaaaagaaggaaactaagaagaaattcaaacttgagccacat
gatgaccaagtctttctggatggaaatgaggtttttgtgtggatctatgacccagttcac
attaaaacatttgtcatgggattaattcttgtgattgcagtaatagctgccaccctcttc
cctctctggccagcagaaatgagagtaggtgtgtattacctcagtgtgggcgcaggctgt
tttgtagccagcattctcctccttgctattgctcgctgcatcctgttcctcatcatctgg
ctgataactggaggaaggcaccacttttggttcctgccaaacctgactgctgacgtgggc
ttcattgactccttcaggcctctgtacacacatgagtacaaaggaccaaaagcagactta
aagaaggatgagaaatctgaagccaaaaagcagcacaagtccgacagtgaggaaaagtca
gacagtgagaaaaaggaggatgaagaagggaaaggagctccaggagaccacggaccagaa
ggctcgggcggagagcgccactcagacacagacagtgacaggcgggaagatgaccgctcc
caacacagtagtgggaacgggaatgattttgaaatgatcacgaaagaggaactggaacag
cagacagatggggattgtgatgaggaagatgacgacaaagatggagaaatgcctaaatct
gcacaagaaaaatcataa

DBGET integrated database retrieval system